Repbase Reports

2003, Volume 3, Issue 3
March 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 53

COPIA4-I_AG

COPIA4-I_AG is an internal portion of the COPIA4_AG LTR retrotransposon - a consensus sequence.

Submitted:
31-Mar-2003
Accepted:
31-Mar-2003
Key Words:
LTR retrotransposon; Copia clade; 5-bp TSD; reverse transcriptase; integrase; COPIA4_AG; COPIA4-LTR_AG; COPIA4-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Pavlicek,A., Kapitonov,V.V. and Jurka,J.
Title:
COPIA4_AG, a family of autonomous, copia-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(3) p. 53 (2003)
Abstract:
COPIA4_AG is a young family of copia-like LTR retrotransposons. COPIA4-I_AG, an internal portion of COPIA4_AG is flanked by >99% identical COPIA4-LTR_AG LTRs. The consensus was reconstructed from 6, >98% identical, copies of COPIA4-AG internal sequence. The consensus sequence encodes the 1322-aa COPIA4_AGp protein (positions 112-4077). COPIA4_AGp: MSTEEANSAGPSRESSAGAAALSGHAVGSNNLAMNVGIEKLKGRENYVSWAFAMKMMLCRERCWDIVTAR DDKAVDKDMDMRALSTIALSLEKHNYSLVMDANTAKEAWEKLKAAFTDDGVFRRISLLQELVSFKLNNFS STEAYVDAIMSTCHKLREIGFEVSDIWVSSILLMGLPKYYAPMVMGLEASGMAMKADAIKLKILQEVKTT CHKDDEALFSRGNPNLRKGGGAMKRSTKEVTCYNCQKLGHFAINCPEKQKHKKNNKTRAMSSVLAMGDVS ECEWYFDSGASSHMAKSGVDFSERQHICHEVSTANNASMKAITKGTVSVNCQEGAVNLLNVLEVPDLATN LLSVSKICKNGFKVVFTERKCEVFDENGEVFASGIAENGLYRLNENRVRTFLSYEIWHRRLGHLNFQSIQ RLKGMADGIQTKQTNTYNCVACIEGKHARESFPTSQERCKEKLELIHSDLCGPFEVESIGGSKYFMTFID DATRKVFVYMLKSKDEAKTVYEKFKSMVQRQSGRQIKLFRSDNGREYVNASMKASMERDGICHQTTCTYT PEQNGVAERMNRTIVEKVRSMLNDAQLPKRFWAEAVNTAVYLINRSPTRALNDITPEEAWSGKRPHLGHL KIFGSTVMVHKPKQKRVKLDPKSERCIFLGYAHNTKGFRVFNVATNEIIISRDIIVVDEGQCEGFGKEQT TPVEFLELLFAEGKDESNSTRNNPINISPTEEASDGQTEETPTRFDQSNETPRRSQRQHKLPSKYKDYVI NRKFVPSSTLANEAENVSSDSDYTTPESESDEALVVFSQREDPRNYAEAMKSEDAKQWMDAIQEELQSIE ANNTWSLVDLPPGRKAIGSKWVFKTKRDVDGNLLRYKARVVAQGFSQQFGTDYDEVFAPVVKQTTFRVLM GIAAKRGMAVKQYDIKTAFLYGDLEEEIFMKVPQGVKVEDNKVCRLKKGLYGLKQSARSWNQRLDQELKR QGYTNCLADSCLYRKRCGKEWCYVLVYVDDLIVAGDNLDMIESLLAELKKSFEVNILGDIRFFLGIEVEK NKQGDYFVNQRNYIKDVIISSGLTDAKPSSIPLDPGYIKIEAEEIELSDNKEYQQLIGKLLYIAINTRPD ISAAVSILSQKISKPTQRDWCELKRVVRYLKGTINYRLRLSEKGCDNGIIGYCDSDWAENRIDRKSNSGY VFKVNGGTVSWTCRKQSCVTLSTAEAEFVAISEGIQEALWLKLLLEELNDVQEVIIHEDNQSCLKILSGE KLSNRTKHIATRYHFTKDLIKKGQISCVYCSTEEMIADLLTKPLARIRIQKLVSLIGLSVSL
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute