Repbase Reports

2003, Volume 3, Issue 3
March 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 49

COPIA1-I_AG

COPIA1-I_AG is an internal portion of the COPIA1_AG LTR retrotransposon - a consensus sequence.

Submitted:
31-Mar-2003
Accepted:
31-Mar-2003
Key Words:
LTR retrotransposon; Copia clade; 5-bp TSD; reverse transcriptase; COPIA1_AG; COPIA1-LTR_AG; COPIA1-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V., Pavlicek,A. and Jurka,J.
Title:
COPIA1_AG, a family of copia-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(3) p. 49 (2003)
Abstract:
COPIA1_AG is a young family of copia-like LTR retrotransposons. COPIA1-I_AG, an internal portion of COPIA1_AG is flanked by 99% identical COPIA1-LTR_AG LTRs. The COPIA1-I_AG consensus sequence was reconstructed based on multiple alignment of 4 copies. The consensus sequence encodes the 1323-aa COPIA1-I_AGp protein (positions 151-4119). MSESHVTIEKLNDQNYAIWKFKMELLLAREKVLTVVKDSKPASPDAAWIANDERARALIGLSLDDSQLIH VMQTSSSKDMWDALKGYHERSSLSSKIHVMRKMFATKMTEGGDISNHLKELCSLRLRLIALGEEMKDPSF VALMLSSLPKSFDGLIVALESRPDEDLTVDYVKGKLLDEGRRRADGADEDKALLSGGKNxTKFWKDRKLT TNKEKQCHYCKKNGHIRKDCRKWAADKRSKLDGESVNVANEDNREEVCLFIGExNETGPWCFDSGATSHM TNDTSILKLIDKSKQSSISLANGDSIKSAGVGxCKLFSMDGNGKRKKVSLDxVCHVPSLTTNLLSVSKIT DNGFExxFDRxGCRVLKGKQVLLIGERKGGLYYLKQTEQAMLVDKNHEASCIHLWHRRFGHRDIEAIMKI ARNNLGSGLNINRCHVKSICGSCCEGKMSRDPFPNSSSSRTSGVGELIHTDLGGPFEVSTARGSRYFMTM VDDFSRYTIIYLxQNKCETENRIREYCxMMKTQFGHYPKVIRSDGGGEYRSNSLKEFFVDHGIVHQQTAP YSPQQNGVAERKNRYLVEMMRCMLAESNMDKVFWGEAITTANYLQNRLPSSLLESTPYEMWHGKNPSYEH LRVFGSEAFVHIPKEKRRKLDKKAEKLVFVGYADNQKAYRFVNLETKTITISRDAKFLEQCEIEKIGTKP KPTTSGGVVVLPLGSTPSLCRAEETTTRENIVQMEASAESSCIRESNMNDTVDxLDVTPYNSASDGELSD EPGAIEMHQSVRRSxRTTKGIAPVRFREESYMAGSSEQNEEPRNLKEVFVCAAREKWISAMENELKSHEE NGTWDALVELPAGRKVVGCRWIFKLKRNAAGQVIKHKARLVAQGYSQQFGEDYDQVFAPVTSHTTFRLML AIASKTQMKLRHLDIKTAYLYGDLDQELFMRQPPGYExKGKEHLVCRLKKSIYGLKQSARCWNQKLHGVL LEIGFQQSAADQCLYIKTEDGKRVYILVYVDDMIVGCVDETLIDSVYHALTEHFEMTDLGPVSYFLGMEV KxEKGNYSVSLEGYIEKLIRKFGLSEAKTAKTPMDEGFLKQQDSSSILKDSTQYRSLVGALLYISVCTRP DIAVSTGILGRNVSNPTESCWVAAKRVVRYLKATKHFKLTFNKAGSDLIGYSDADWAGDTITRKSTSGYV FFYASGAVSWASRKQTSIALSSMESEYISLSEATQEQMWLTRLMKDLGEHIENPVKIFEDNQSCICFVNS DRTNRRSKHIETKEHFVKQQCESRKMMLEYCPTEEMVADILTKPLGATKQRKFTEMLGLHGTR
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute