Repbase Reports

2003, Volume 3, Issue 3
March 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 43

BEL7-I_AG

BEL7-I_AG is an internal portion of the BEL7_AG LTR retrotransposon - a consensus sequence.

Submitted:
31-Mar-2003
Accepted:
31-Mar-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; PHD domain; peptidase A16; BEL7_AG; BEL7-LTR_AG; BEL7-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V., Pavlicek,A. and Jurka,J.
Title:
BEL7_AG, a nonautonomous family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(3) p. 43 (2003)
Abstract:
BEL7_AG is a young nonautonomous family of Bel/Pao-like LTR retrotransposons. BEL7-I_AG, an internal portion of BEL1_AG is flanked by BEL7-LTR_AG LTRs. The BEL7-I_AG consensus sequence was reconstructed based on multiple alignment of 11 copies; they are less than 1% divergent from the consensus sequence. The consensus sequence encodes (pos. 393-2552) a 720-aa BEL7_AGp protein composed of the PHD and peptidase A16 domains (pos. 18-62 and 111-260, respectively). The reverse transcriptase and integrase domains are not present; therefore, this family is a nonautonomous one. BEL7_AGp: MTTKRNLTPFVDNDNGSCRLCSRIDDPNMVQCDECDRWFHMACAKLSRLPKADEPFLCIKCTKDYAKIKA PASTGSDQNTAIAALIEALKGSSLDTNTYLKRLTFDQLPDFDGKAKEWLKFKRAYEETTKQAKYTNVENM TRLQHALKGEAYKCVHRLFLEPDNVPEIITKLEEQFGRAELVYDELLKDVQNIRVENQHKIPDLSDAIQD MITNIKAINMPMYLQDHRLVNELACKLPTDRHLKWIEYKSTNIKPGVLPSLEDFGKWLLPQAKVLKELPK RPERPKHSMNVHQSSAHNTKRPFNHNHFGNAQNNSPATNTYARNAIDYTAQNCTAARERGPHPCEETHHR LHFTADAEENCHQEQKILYQIVPVVLRNEDKTLKTFALLDSGSSFTLIEEETANQLQLEGPTEPITMTWT QNLSIREKESRRVSCLVKGEKEKKERVLEKMRTVKNLQLPRQSINCNVLREKCPHLRGIDISDYESARPT ILIGLDHSHLLIPLGRKMGRSDEPMAIKTKLGWTVFGMNVKGHEAPHNQPMIHYDADSTMISKEIDRGKE IIQKPFVETVPNRAWSEDQRIAEPDEEDRGISIPVLHHHEAVVPDSSMAPLPLCGTHPHNPSPLHTGVDH LEPPDITTQRFVEREVRQPCPGESAAVLMEMRINPQPYVHPPLTNEEDEILSRRGIGSLTTKTLRHRGRP HRRRALLRPAIGLASNAGSQ
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute