Repbase Reports

2003, Volume 3, Issue 3
March 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 41

BEL17-I_AG

BEL17-I_AG is an internal portion of the BEL17_AG LTR retrotransposon - a consensus sequence.

Submitted:
31-Mar-2003
Accepted:
31-Mar-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; PHD Zn-finger; peptidase; reverse transcriptase; integrase; BEL17_AG; BEL17-LTR_AG; BEL17-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V., Pavlicek,A., Drazkiewicz,A. and Jurka,J.
Title:
BEL17_AG, a family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(3) p. 41 (2003)
Abstract:
BEL17_AG is a young family of Bel/Pao-like LTR retrotransposons. BEL17-I_AG, an internal portion of BEL1_AG is flanked by BEL17-LTR_AG LTRs. The BEL17-I_AG consensus sequence was reconstructed based on multiple alignment of 11 copies; they are ~2% divergent from the consensus sequence. The consensus sequence encodes a 1842-aa BEL17_AGp Bel-like protein (pos. 34-5559). BEL17_AGp is composed of the PHD Zn-finger (pos. 9-56), peptidase A16 (pos. 223-353), reverse transcriptase (pos. 839-1006) and integrase (1540-1700) domains. BEL17_AGp: MGPKRNDHCQACGDQRDDPDFVACDKCNLWWHFSCAGLTEPAEAVEQRKWLCVACQAKERSGLIQRTPVK HTEQMEAANANLNLEEVTQNVAEKHNLKLVEVIQQAAETPMPSSSGTSYNAVSKPNLTPAKVSDSVANRL AIMKRRQEAERKRMELELQLKFVKEEEDLLSEELGVMAISGASTVTPSRPDGESMRGSQQDERGPAPRLE SFHRNVPTELPEFSGDPAEWPVFIAHYDYTTEKCGFSNWENMIRLQKALKGPALEVVRSRLVLPEVVPQV IATLRSRYGRPEHLISALIGKMRRMPAPCREKPDTVVAFGEAVRSMVDHMQAAGLRAHLTNPLLLQEIVE RLPTSEQYSWARHIRGVTEPDLIVFGEFMTEWMDDAETLTRLDSPSLKAVDRKKPNTKGYVHAHVENQGA TTSGTRAIQVGQSCFVCNKRGHLVSKCFAFGAMAVKDRWRKARALSLCFSCLERHNWRTCQNRAVCSIGG CTRRHHALLHGAEESREIGSEQNNIESREGGIDGGVIAESNHHQYVSSSSKALFRIVPVTVYGPAATVTT FAFLDEGSSMTLVDDDLAEQLGVEGKVEPLCIRWTGNTTRVEAGSRRVNLKVGPVGSTKRFAIHSVRTVP GLNLPRQSFVQDEGRWQHLERLPIRQYRDAEPKLLIGLDNLRLAVPLRTKEGGVGDPIAVKTRLGWCIYG KPANLECERLLHICECNDQGNIHETIREYFDMQLIGAAHGVEQDPDERRAKQILDTTTARIGKRFESGLL WRKDDIELPPSIDMARRRFNCLERRMERDGHLKEQVHRQIRDLLSKQYVHKATLRELEEADQRRVWYLPI GVVTNPNKPGKVRLIWDAAAKAHGTSLNDMLLKGPDELSSLLGVLFRFRLYAVAACADVKEMFLQIMIRK EDKHAQRFLWRYEPTDELETYIVDVVMFGSACSPATAQYVKNRNAREHMEQFPRAVEGIIESTYVDDFLD SFETEEEACQVSHDVREIFRNGGFELRNWTSNSMELMRCLGEANGDIKCLSSMGDEAERVLGMRWNPASD ELGFCTRACTTVSDLLIAERIPTKREVLRCVMSLYDPLGLLAMFVIHGKILIQDLWRTGTQWDEEINDMQ LRHWRRWIDLLPAIADLRIPRSYFAAASKKMYENGEWHLFVDASQHAYACVLYLRIFDDAGEPQCTLIGG KAKVAPLKPLTIPKLELQACVLGARFLRYTQEHHPINVRRRVLWSDSTVALSWIRSDPRNYKPFVAHRVV EILESTSVDEWRWVPTDHNPADEATKWKGKPNFDFGGNWFQGPEFLLHGEDDWPSQRHNSDNPSEEIRQV NLHVEDSNTGLLPIRYERFSRLERLQRMIGWIVRYVGNLRRKYRGEPILGGALRQEELYEADKILWRQTQ LEYYPEEVRILSLDDNDGKPGGRTVSKQSHIYHLLPFVDDEGVLRMRGRIGAAADVPYSAKYPVILPRGS RLAELIVERYHRLYRHANNETVTNELRQQFQIPKLRALVTKTVKNCVFCKIRRSLPQVPPMAPLPKERLT PFVRPFSYVGLDYFGPVLVKRGRSNEKRWIALFTCLTVRAIHLEVVHSLSTESCVLAVRRFVARRGAPVE IFSDNGTNFLGASRQLRREIEERNETLAAIFTNAHTRWTFNPPGAPHMGGVWERMVRSVKAAISTVMEAK HAPDDETFETVILDAEAMINSRPLTYVPLDPENQEAITPNHFLLGSSSGVKQQPVLPTNYRDSLKGNWKL AQHMLDGIWRRWIKEYLPVISRQSKWFENVREIRKGDLVLVVDGTIRNQWKKGIVERIMAGPDGHIRQAW VRTNTGAVRRPVAKLALLDIAT
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute