Repbase Reports

2003, Volume 3, Issue 3
March 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 33

BEL13-I_AG

BEL13-I_AG is an internal portion of the BEL13_AG LTR retrotransposon - a consensus sequence.

Submitted:
31-Mar-2003
Accepted:
31-Mar-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; peptidase; RING Zn-finger; reverse transcriptase; integrase; BEL13_AG; BEL13-LTR_AG; BEL13-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V., Pavlicek,A. and Jurka,J.
Title:
BEL13_AG, a family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(3) p. 33 (2003)
Abstract:
BEL13_AG is a young family of Bel/Pao-like LTR retrotransposons. BEL13-I_AG, an internal portion of BEL1_AG is flanked by BEL13-LTR_AG LTRs. The BEL13-I_AG consensus sequence was reconstructed based on multiple alignment of 6 copies; they are less than ~1% divergent from the consensus sequence. The consensus sequence encodes one 1762-aa BEL13_AGp Bel-like protein (pos. 429 5714). BEL13_AGp is composed of the peptidase A16 (pos. 150-290), RING Zn-finger (pos. 385-422, reverse transcriptase (pos. 800-930) and integrase (pos. 1480-1620) domains. BEL13_AGp: MSVRRSDVHKTPAESEEWKIAPIDMEEAGPSSEIPAGLDEAKEVHRPIDKNQCIRKHFLNKLQRIEEALS GTSLGDTTFLKGCANRLTSLASEYEKWHQTVLETADMENFEDGEEEYARFEKRHFNLLLRIERGMSITTN VSQSRVKLPELRLPTFDGSLEAWLPFRDSFSSLIDANASLSDVDKLRYLKGALTKEANKLIADIEITSAN YIVAWELLKARYENKKLAVKRHIDALFLIPVMKKDSYESLIHILDSFERSVNITKQLGVATEGWSVLLAH MLHSRLDSATQMHWEAHHRSTDVPEYYELLTFLKSHALVLQAMLSPGQKKEQYTSSWKQRSKSEVHVVNS SMEICSFCKKGSHSPFKCDMFSGWTVQERYDKVKEKKLCINCLLPGHIMKNCTSSVCRVCNKKHHTMLHK PVQTSNSAEASPNDREIVTQPDPPADQNVVTYCGNALLTNSIETPSTILLPTALVKIELPDGSLHWARAL LDGGSQINLVTERLCQRLQVIKKRENHPIGGVGQSKHVSSHSTQLTIKSHCTSFKANWKFHVMRYITWNL PAEKVNKTRYCIPNTCTLADPKFYEPSSIDLLIGRESYDELMLEGILKLVPEKVMLQNTELGWIVSGRVE LERRPTSSIVNLVCTNQDLENQLTKFWEIESCNTNSTMSIEETSCEKVFSETTTRDDQGRFIVTLPTKKD IVPQLGNSFEIAKRRLNSLNRRLASNKDLKAAYIAFLEEYVQLGHMEEITEQHTNIDTPIYYLPHHCILR PDSLTTKLRVVFDASCATDSGLSLNDALMVGPVVQDDLVAIMIRFRLPKFAIVADIEKMYRQVWIKKEDR SLQRILWQNCPENKLRIYELKTITYGTASAPYLATKCLQMLSVHGTSTHPEASRVLANEFYMDDLLTGVE TQTEGEELCHQLTDLLSSAGFTLRKWASNSSQILQSIPVDQRDTSGLCSLDINSSIKTLGLKWIPATDEL GFCVPIWTEDEQITKRIALSDASRLYDPLGLIGPTIMIAKCFMQNLWALQKAWDEPLEKELHKQWNQFRQ QLSIVKDMRIPRRVVGSTHRIEIHGFSDASMKAYGACLYMKSVSEDGKVSVNLLCSKSRVAPLANSKRQK NVTLPRLELSAALLLCHLWQKVKDSLKHEYSCFYWVDSTIVLHWINSSPSRWKPFVANRVSEIQHLTEPR HWNHVPGDQNPADIISRGMMPSQLQESCLWWHGPEWLSQPSNTWKLHHPILDCPPSEFEERKTVLIINKQ SNIHHPIFSLKSTFSGLVRLMAYMQRFSYNCKPVNRNNRRQGYLQTFELHAARENLVRIAQNESFADDIR SLETAGEVKTSSSLRSLTPMLVNGVLRIGGRLRNAPVAYDRKHPMILPYKHPLTRLVMDFYHLKTLHAGQ QLLIASVREKYWPLRVRNLARQVVHECIQCFRCKPSTMEQIMGDLPAERVTPTFPFLNTGVDFCGPLFYR SASRKSAPVKCYVAVFVCLATKAIHLELVADLSSDAFISTLKRFVARRGKPSLLQCDNAKNFRGAERKLK VFHQQLQQQQFQQSISSYCGPEGIEFRFIPPRSPHFGGIWEAAVKSFKHHFRATIGTSILRRDDLETIIA QVESCLNSRPLTPISTEPEDLEVLTPGHFLIHRPLVAVPEPSYEEVPSNRLDRYQQNQEFVRRIWNRWST DYLSGLQPRTKWTKQRDNIHIGTLVLMKEDNLPPLKWSYGRVTQIYRGDDGNIRVVTVKTKDGEYKRAIT KICVLPIHSNTE
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute