Repbase Reports

2003, Volume 3, Issue 3
March 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 27

BEL10-I_AG

BEL10-I_AG is an internal portion of the BEL10_AG LTR retrotransposon - a consensus sequence.

Submitted:
31-Mar-2003
Accepted:
31-Mar-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; PHD domain; reverse transcriptase; integrase; BEL10_AG; BEL10-LTR_AG; BEL10-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V., Pavlicek,A. and Jurka,J.
Title:
BEL10_AG, a family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(3) p. 27 (2003)
Abstract:
BEL10_AG is a young family of Bel/Pao-like LTR retrotransposons. BEL10-I_AG, an internal portion of BEL1_AG is flanked by BEL10-LTR_AG LTRs. The BEL10-I_AG consensus sequence was reconstructed based on multiple alignment of 7 copies; they less than 1% divergent from the consensus sequence. The consensus sequence encodes a 1746-aa BEL10_AGp Bel-like protein (pos. 451 5688). BEL10_AGp is composed of the PHD (pos. 32-77), protease, reverse transcriptase and integrase (pos. 1400-1550) domains. BEL10_AGp: MLFCHTTVCRRIVVKMATKKSNYFVENKNGACRLCTEPNGDSPFVRCEECDRYFHLACAKLSAVPTAEEE WLCIKCQDIKIQYQQEEKKSTPDQAILELAMVLQNNSLEASRHIKKTTLVNLPEFDGKPQDWPHFKKTFE DTTIEAGFSKLENLNRLQRFVKGEAEKAVRALLLDPQNVPAIMGRLEEQFGRADQVYKELLKDVVKIKVE GQMKIMELSDALDNLVTNIKILGKRSYLNDPRLIDELLAKLSIDKQLNWAQHKASLEAANSEITLDQFND WMRQISKALRSLPKRTDRPQNKVNVHKYHNHKPPRNSQQMNIAQNLHTVCRLCKGQHTLPECEIFLQKNI SDRIAFTTQHHLCFTCLLSSEHVQRNCPLSKVCSVQGCIRRHHPLLHEVPQPIYYHYNDVRVYYQIVPIT VRNGSVAMKTFAFLDAGSSLTLMEEDLANKLGLQGRQDPLTMTWTQNLTVEQDTSRRVQLTIVNDQGKEF LLKEVRTVKNLQLPQQTIDTNRLLALYPHLKGIKIKSFTNAYPTILIGLSHSHLIMPLDRRMGRPEEPMA IKTKLGWIIFGNEYTQPATRSDHFMVHKNEEIMNRMIQQYFSTEDFGVKVTKPLVPKEIEQANKILEKTL EKKDGYYQVGLLWKPEVAHFPNSYPNALKRLVSLEKQLNKNRELQVWAKNTFADYIQKGYLRKLTPSQVA IATPKTFYLPHFVVVNRNKPIPKPRLVFDAAAEVNHISLNSQLLSGPDEMASLFGVLLRFREGNICVTGD IQEMFHRVRIREEDQDSQRILWRDCENRCPDVYVMQVMTFGATCSPACAQVVKNTNAAAHAETHPLAVDP IVRQHYVDDYLDSFFTMEDAIETVRQVIEVHKAADFHIRNFTSNRGELLKTIPQDRVQQKTTSVQIEEKG QDYEKILGVHWNPTIDYFGFQVKMNKVTKDRPTMREVLSFVMSVYDPLGLISHVTIAGRILMRELHVITK DWDSTIPDELQEKWEECLRVVKSAEKIRIPRQLVITLNDPLELHTFVDASENAFAACVYARTVTKEGTVF INLVAGKARVAPINPLSIPRLELQAAVLGVRLTESIRKELRLFVKHITYWSDSEVVLSWLKNRRKYAQFV AHRVGEILESSRADQWRWVPSRENPADIATKPYPNDWIWVNGPSFLRNNESDWPHKEIVETNEECRVVAV HQHAETAIPVENYSSWPRLLKHLTILKKFADFIRNRSAFTRSIQPNDVQLVRNGMYRSAQWEGFPEEMAT LTKGQPVPKQSPLNKLSPFLDSDGIMRSRGRLENISTLPQSTRTPIILPQKPRLVKLLVRNFHERYLHQA DNVVIGAIRQEYWIVNLRAVLKNIKKCCQKCILKTAAPVAPFMAPLPEFRAHPYTPPFYNTGVDYFGPIE VQVKRSLEKRWGAIFSCMNTRAVHIELAEKLDTDSFMVCLKNFQNRRGKICNMYSDNGKNFVGAERELRE LVTEIDKRMGHESALKYEIKWHFNPPSAPHFGGVWERQIQNIKKGLRHMFSEWSHRHPTPETLRATLIEI EAMLNSRPLTHIPLENEEDEILTPFHFLIGRNGSHIPPVVNETSAANRQQYKLTQHYSKIFWDRWKKEYL PTLIRRNKWTNHVEPIKVGDIVVLFDDNAPPGKWIKGRIVKANMAPDGQVRSVEVKVGENILKRPAVRVA VLNVEQKEHLLLHTTSQQHQGTNRIRPLQPNNDNNETKPPRKKTKIAPCHWAKQLLENNPPSTSTN
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute