Repbase Reports

2003, Volume 3, Issue 2
February 28, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 17

HARBINGER1_AG

HARBINGER1_AG is an autonomous DNA transposon - a consensus sequence.

Submitted:
28-Feb-2003
Accepted:
28-Feb-2003
Key Words:
DNA transposon; Harbinger superfamily; transposase; MADF/SANT; HARBINGER1_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
HARBINGER1_AG, a family of autonomous Harbinger-like DNA transposons from African malaria mosquito.
Journal:
Repbase Reports 3:(2) p. 17 (2003)
Abstract:
There are ~20 copies of HARBINGER_AG in the genome. They are ~98% identical to the consensus sequence. HARBINGER1_AG copies are flanked by the TWA 3-bp target site duplications. This element has imperfect 40-bp terminal inverted repeats (5 mismatches) and subterminal TIRs (positions 54-106 and 5269-5321). The HARBINGER1_AG consensus sequence encodes two proteins: a 471-aa HARBINGER1_AG1p transposase and a 245-aa HARBINGER1_AG2p MADF/SANT-like DNA-binding protein. The MADF/SANT domain is present in various transcriptional regulators and is involved in the chromatin remodeling. Putatively, HARBINGER1_AG2p was recruited by the transposon from the host genome. HARBINGER1_AG1p is encoded by 4 exons: positions 452-805, 875-952, 1396-1596 and 2345-3127. HARBINGER1_AG1p: MSEPELENDNNEVRDRSRSRSRSPQARRLWVQDLFLNRNETGNRLLTDITTSGIYETMNR FLRMKKEDFFHLLSLVGPKIAKMDTDFRKAITEQERLLITLRYLATGETFTSLQYVFRVS RHSISRIVKETCACLIEALRDYVKSQPESIPIRGCSGCARSELESNPTRGCNEFGSTRLC FLAPTDLSGRPELVATEPTVARPDPNSQHQRLPSTEEEWLAISRRFEQRWRFPHAIGAID GKHVEIICPRNSGSEYHNYQKFFSIVLMVVVDADYNFLWADAGGKGGISDGGIFKNTRLY HKLENDQLNIPPATPLQVPYQTPVPYFILGDKAFAFTNYCLRPYSGVHPPDSMERTFNKM HSTCRMPVENSLGILANRWRVLKGIQLQPDVAKNIVLTTVYLHNFLRKHASRDTYTPPSA FDRVVRGRRVDGDWRSEGGLTDLQNIASRPSENLADIRNHIANHLKHNRST HARBINGER1_AG2p is encoded by 4 exons in -strand: positions 5133-5095, 4587-4359, 4287-4196, 2229-1852. HARBINGER1_AG2p: MEQAGSSRRNEKIDHEKSLRFIAEVQKHRVLWEKKNKNYKNVVLKGDAWAAIAAKEEVSP QDAKHLWSRLLGIYRTNKAKVKKTTQTGAGNDDVFRPRWFAYQAMSFVDEATQDAVHVDT LGYDDEGLTPRSLVEAAYAVPQSLDDIDWDAAVAFDPEPFSPTPSSYPSALSVTPGTIRE GNGVSGALNNRLQQPVSGATGAPETADPDDFGRYVADELRLIPSPKRRRIMSIQRELLET LKKNL
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute