Repbase Reports

2003, Volume 3, Issue 2
February 28, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 13

CR1-1a_AG

CR1-1a_AG is a CR1-like non-LTR retrotransposon - a consensus sequence.

Submitted:
28-Feb-2003
Accepted:
28-Feb-2003
Key Words:
non-LTR retrotransposon; CR1 clade; DNA/RNA-binding; endonuclease; reverse transcriptase; CR1-1_AG; CR1-1a_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
CR1-1a_AG, a subfamily of CR1-like non-LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(2) p. 13 (2003)
Abstract:
CR1-1a_AG is a subfamily of CR1-1_AG non-LTR retrotransposons. The CR1-1a_AG consensus sequence was reconstructed based on multiple alignment of ~10 copies identified in the sequenced portion of the genome. Given the ~2% divergence of these copies from the consensus sequence, transposition of CR1-1a_AG occurred less than 1 million years ago. The CR1-1a_AG and CR1-1_AG consensus sequences are 79% identical to each other. The 3' terminus of CR1-1a_AG is composed of the CAT microsatellite. CR1-1a_AG encodes two proteins: a 444-aa CR1-1a_AG-ORF1p (positions 441-1772) and 932-aa CR1-1a_AG-ORF2p (positions 1776-4571). CR1-1a_AG_ORF1p is DNA/RNA binding protein composed of the PDH domain (positions 3-38) and gag-like zinc knuckle regions (aa positions 340-444). CR1-1a_AG-ORF2p is composed of the AP endonuclease and reverse transcriptase domains. CR1-1a_AG-ORF1p: MECLACSAVVLINDDPILCAGKCGGNFHRRCVTPSLSKTAAKIINENKNVLYMCDRCLEHKSGLAGMDVD VSGSYDLLTQSIKNLESNVSVWISSALEKGIETLKTELCAQVERKLEQTLRESLSAVECSNKAKEALRAT FDDTKARETVEDESWATVTKKRKRTNSGNSNVQTIINRFDTGNVNSTPKISDKVTGPILANKNKNSKTLV IVPKVGQSCDKTRADLRAKLDPRKQQVSEFRNGKDGQVFVQCSAQVKLDELRKEVENILGDEYATDLPLS RVKIIGMSEKYTDSHLVDLLKSQNEGIPWKQVKVIGMFENKIYKYQKYNAVLEIDYESDLCLAKLGKINV GFDRCKISKSVHVMRCYGCGQFNHKSTECKNKQACSKCGDEHKTSECTSSSLKCVNCVLANSVRNLKLDV RHAANDYNCPMFKKQIERRMQLSQ CR1-1a_AG-ORF2p: QVGEELGRFREILYFNVAGLSSNYAMFRETVEKVQPLLVLISETHVIEEEAFQQFHINGYRVVSCLSHSR HTGGVAVYARSEIVLKVIFNESLEGNWFLGVAVSKGMTAGNYGILYHSPSASDSRFVDILEEWLDRFLNF SKLNIIVGDFNIDWLNVEKSAKLKSLMDSVNMKQKVNEFTRIARQSRTLIDQVYSSTDSIKVTTDPLLKI SDHETLVLNINVKRCETIQRKFKCWNRYSKFALCNHVSQGLRQEAPSFNEAADLLWNTLKKAMGTLVEEK TILSRETSRWYTLELSRAKRKRDEAYQHFIRSNSGYDWTEYTRLRNTYSRNLKTTRRNYFSGEISKHKGN SKELWKVLKSLLRPEESRVSVVKFDGLVESEDSIICQKFNLFFVNSVLDINQNIADARAPDSLFCNDAPG NQFKFQKITKEKLKTICFSLSKTAGIGNVNCNTIQDCFHVVGESLLIVINQSLEEGIFPETWKESLVIPI PKVSGAASAEEFRPINMLHVLEKVLELVVKEQLVQFLTRNDLLISEQSGYRQGHSCETALNLVLARWKVL MDRKESIVAVFLDLKRAFETISRPLLLQTLRRFGIVGKELNWFENYLKDRTQRTVFGNSISEPIENTLGV PQGSVLGPILFIMYINDMKQVLKSCEINLFADDTVLFISHKDIKQAESLINFDLNALDGWLRYKKLALNV KKTSYMVMTAGVLDSPPSIVINKEPIERVRQVKYLGVILDDRLKFNTHIDWVIAKVASKCGVISRLAKDL DFFGIVNLYKSLISPHFDFCSSILFLGNKGQIKRLQRLQNRIMRLALGCGRRTSSFVMLDILQWMSVEQR IVYQTMTFIFKLLGGLLPGYLGERIVRGSDVHRHCTRRANEPRVPNLISHGARNSLFFKGIQLYNRLPGE IKNASNLPDFKRRCAAYVKQTV
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute