Repbase Reports

2003, Volume 3, Issue 2
February 28, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 12

BEL3-I_AG

BEL3-I_AG is an internal portion of the BEL3_AG LTR retrotransposon - a consensus sequence.

Submitted:
28-Feb-2003
Accepted:
28-Feb-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; PHD zinc finger; reverse transcriptase; integrase; BEL3_AG; BEL3-LTR_AG; BEL3-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
BEL3_AG, a family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(2) p. 12 (2003)
Abstract:
BEL3_AG is a young family of Bel/Pao-like LTR retrotransposons. BEL3-I_AG, an internal portion of BEL1_AG is flanked by BEL3-LTR_AG LTRs. The BEL3-I_AG consensus sequence was reconstructed based on multiple alignment of 4 copies; they are less than 1% divergent from the consensus sequence. There is no tRNA-like PBS at the 3' end of BEL3-I_AG. The consensus sequence encodes one protein: a 1749-aa BEL3-I_AGp (positions 204-5450). BEL3-I_AGp is composed of the PDH domain (aa positions 12-59), reverse transcriptase (positions 740-940) and integrase (positions 1440-1610) domains. BEL3-I_AGp: MQEESAVIADFTCAVCDKADSVDSLLQCDFCDKWYHYECAHVDKTVETRAWWCAECEVKTKLASGKKDDEI ARLKREMEALKATTEKALALIREKDAEVARLSKSSERTSFSPGESLPCSTAKRISVNEEGDLSQSQIAARQ AVRYELPSFNGNPEEWPIFLSTFRRSSRTFGFTEDENILRLQGALRGKALRTVQGRLRHADNLEEILSALE KSYGRPDVLVNTLLEQIRESPPIKSERLDSFIEYGDLVAEICSTIKASGTSDRLYDAALLQELVDRMPAYL RWSWGMHSQELKSVTMSEFGAWIQKATDGAMAVTPPQLKKKTTTRQVHAQHVETHQPQPRRHRECALCNSD TCGTIAECRVFNRLSVADRWDKVRTLKLCKRCLGKHYGPCSKRDDCGVQGCVAKHHRKLHRVTSEERVEIN HHGTRSDGTLLRYVPVKLHGESGPICTHALLDEGSTVTLMEQELAGQLGVSGVLDPLCLQYSAGERRDERD SERVAVQVSSAEENASAFSMADVRTVSRLSLPIQSVDVNELKRKYKHLEAIPAASYEAVSPRLLIGIDHYR LTRPLKTIEGQPGQPTATKTRLGWLIFGKCTDNANDTSIVQPESSYHVCDCQGETSRADRMMAAYFEVEGY GPAKEPLLSKEDQRAMSILQNNTKHVDGRYTTGLLWRSDNVFMPENRQMALSRMECLERKMSRDTSLAEKI NAILEDYLEKGYARPIRADELKTFYPRKWYLPVFPVTNPHKPNKVRLVWDAAAEVRGISLNKKLLTGPDLL TPLQAVLFRFREYRVAVAADIREMYHQVRICDDDVHSQRFLWRWGNTNAEPQEFVMLRMTFGAACSPSTAQ FVKNENAEKYRSLYPRAVRCIHEEHYVDDMLTSVETEPEAIELAYQVSLIHNNAGFSLHNWLSNSIRVVTA VKGTESTLKEMDFEPCLKPEKVLGMWWDTTTDSFGFKLSRVRHLELARKDKPPSKRQMLRTLMSIYDPLGL IAGVLFYLKVLLQEVWRLHLGWDDEVPEEIQHKWDAWMERLPELESFIIPRCYRQLASLTESSLQLHVFVD AGADGYAAVAYFRFECHGRIEVSLVGSKAKVAPLKYLSVPRLELQAAVMGCRIASSITSAHRETISGSYFW TDSTDVIDWINADHRKYSIFVAHRVAEVLDTTNVDDWRWLPTKLNVADEATKWTNLQHHLASERWFSGPEF LQLPEAEWNIPRRVPSETSEEVRKKDRLKLVGIHIARPIFIDYERFSRWTRLVRTMAYVCRYVNIITKTKS PSTGPLNRDEIQRAETVILRDVQRNAFTDEYAILWKARENSTTPSWKSPIPRSSLLFKRSPYMDEDGLLRL SGRIDRCRYVDPGRKRPILLPRRHRVSELIVDDVHRRYKHGSQETVVNEVRQRFDIPALRSVCRHVRLQCR TCTLLYAKPASPEMCELPAARLAAFSRPFSYTGIDYFGPMVIVNGRKTEKRWGVLFTCLTVRAVHIELVQS LSTSDCLMAVRSFMARRGTPIEIVSDRGTNFVGADRELKEAAERVDSAILNEFGSPDPVWKFNPPAAPHFG GSWERMIQSVKRMLSRTLTERHPTEAVLSAALIEVENMLNSRPLTHVPVDGEDEEPLTPNHFLLGSSAGMK PLVKPDDSPAGLKQNWRAVQAKMNELWKKWIKTYLPTLVRRTKWFESCKPIETGDVVLIVDENSPRNCWPR GRVERVVPSKDGVIRRVVIKTAKGTMLERPVVKLVSLNVAPRVIV
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute