Repbase Reports

2003, Volume 3, Issue 2
February 28, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 10

BEL2-I_AG

BEL2-I_AG is an internal portion of the BEL2_AG LTR retrotransposon - a consensus sequence.

Submitted:
28-Feb-2003
Accepted:
28-Feb-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; PHD zinc finger; reverse transcriptase; integrase; BEL2_AG; BEL2-LTR_AG; BEL2-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
BEL2_AG, a family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(2) p. 10 (2003)
Abstract:
BEL2_AG is a young family of Bel/Pao-like LTR retrotransposons. BEL2-I_AG, an internal portion of BEL1_AG is flanked by BEL2-LTR_AG LTRs. The BEL2-I_AG consensus sequence was reconstructed based on multiple alignment of 5 copies that are ~3% divergent from it. The consensus sequence encodes one protein: a 1750-aa BEL2-I_AGp (positions 239-5488). It is composed of the PDH domain, reverse transcriptase and integrase domains. BEL2-I_AGp: MASRRLYFVENEQGACRLCTKPDDIDDMVRCDECDRWFHASCVKVIRLPDEDEEFVCVKCxNDRAEYMxI SQSTNQDTTLKALIEALKMSGLTSSTHIKRMTLNSLPNFNGTSKDWPKFKRAFEETTEEGSFSNVENLNR LQHALKGEAERCVRRLFLEPDNVPIIMKKLEEQFGRPEQVYQDLLGEVLKVRVENQMKIPDLSDALEDMI INLKAIKKEGYLQDHxLVDELIFKFSTDKQLKWIEFKSSLEKxNKIPTLEHFSEWLYPIAENIRKLPKRN ERFRQPLNFHRPQFSPNQQRPAEINNNRPMNRPPQPHNSHPMNTQTRPFNTRVRNVQRFFQPCPCCQGSH ALYRCERFKNIPVHERLEIVVNSQQCQACLTSNNHSQNNCNAARECGIQGCRETHHQLLHTGDTVRMNYH QTIQNVYYQIVPVVLRNNNHTLETYAFLDAGSSLTLIEENTANKLHLNGVTDPLTLTWTQNLSVQENCSR RVSCMIKGVNEKKEHLLNGIRTVKNLQLPSQTLSGSILAARYPHLKGIKLSDYQKARPTVLIGLNHSHLL MPLGRKMGRPEEPMAIKTKLGWLIFGIDKICLSETNHLMIHKSEDLMTEMMRRYFSTEEFGVKPVKTVKS QALERAETIIEKTLKKTDGRYEVGLLWRDDDVILPNSYSNALRRLATQEKQLAKDPGLKNWLCKTFEEYQ QKGYIRKLTKEELKRHSQKIFYIPHFVVVNKNKPIPKPRLVFDAAAKVNGVSLNSLLLTGPDEMASLFGV LLRFREGPICVCGDIKEMFHQVKIRKEDQDAQRILWRDGDSTRTPDTYVMQVMTFGATCSPACAQVVKNR NAEANSEMYPLALEPIRNQHYVDDYLDSFFSMEKAIKTVTEVIQVHENGGFHIRNFISNKRELMEAIPQE RHQVKAIVDIKEKDSCVEKILGVQWNTQLDCFGYKVDVGRINLEKKPTKREALSFVMSAYDPLGLISHIT IQGRILMQSINAATNDWDTQIPDSLHGKWIEWLKMITSVKDLAIPRPIVASIMNPVEIHTFVDASQEAFA AAVYARSNFNGCFVVRLVAAKSRVAPTKALSIPKLELQAAVLGARLTASVIKELRLKISRTIFWSDSKTV LAWINSEHRKYEVFVSHRVSEILDTTSANQWRWVSTKDNPADIATKITSNSWTWYNGPQFLQEHERDWPG VHEVAVEQHLVTVHKETIAPEYYFSSWDKLLKHQTVMKKYVDFLKNRSNFSRTISYRDMETAKLSLLRKA QWEGFPEEMEALEKRKEISNKSSIRTLVPFLDEKGILRSRGRLENASCLPYSARLPIILPQRSRVVKLLV RDYHEKYMHQADNVVIGVLRQNYWIINLRTVLKNVKSCCQRCILNTAAPKAPLMAPLPTYRTHPYNPPFL HTGVDYFGPLDVTVKRSTEKRWGAIFTCMSTRAVHLELAEKLDTDSFMVCLNNFLHRRGKITHLYSDNGT NFVGAEKELKKIVEDIDLRMGREAALKYKIEWKFNPPAAPHFGGSWERLIQNIKKALRHMVTEWKTRHPT PETLRATLIQIESILNSRPLTHLPLTSEEEEVLTPFHFLIGRGVDSLPAPTETSQVDRQQFRLAQHNAKT FWDRWKKEYLPTLIKRNKWTCKVEPIKVNDIVIITNDNAPPGQWLKGRxVETATAPDGQVRSVSVKTVQG VIKRPAVKVAVIDVKQKEHLLFVKKPPHSPTKRKVLSEENLQKVPPKKRMIAPCNWAPKLVQQLKKEDDV
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute