Repbase Reports

2003, Volume 3, Issue 2
February 28, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 8

BEL1-I_AG

BEL1-I_AG is an internal portion of the BEL1_AG LTR retrotransposon - a consensus sequence.

Submitted:
28-Feb-2003
Accepted:
28-Feb-2003
Key Words:
LTR retrotransposon; Bel clade; 5-bp TSD; PHD zinc finger; reverse transcriptase; integrase; env; BEL1_AG; BEL1-LTR_AG; BEL1-I_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
BEL1_AG, a family of Bel/Pao-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 3:(2) p. 8 (2003)
Abstract:
BEL1_AG is a young family of Bel/Pao-like LTR retrotransposons. BEL1-I_AG, an internal portion of BEL1_AG is flanked by BEL1-LTR_AG LTRs. The BEL1-I_AG consensus sequence was reconstructed based on multiple alignment of ~20 copies. The consensus sequence encodes two proteins: a 1771-aa BEL1-I_AG-ORF1p (positions 1204-6516) and 502-aa BEL1-I_AG-ORF2p (positions 6452-7957). BEL1-I_AG_ORF1p is composed of the PDH domain (aa positions 13-54), reverse transcriptase (aa positions 745-900) and integrase (aa positions 1421-1569). BEL1-I_AG-ORF2p is a putative env-like protein. It is distantly similar to the env-like proteins encoded by Tom and Ted retrotransposons from Drosophila ananassae and Trichoplusia ni, respectively. Some copies of BEL1_AG are nearly identical to each other. Therefore, BEL1_AG can be still active. BEL1-I_AG-ORF1p: MDIIFKSNPKGNCKLCKNPDEWDTQVNCIECDRWLHLKCLKLEGPVKKYVCPKCYTIAEERKGNREALMQ TERLLKEKTEAEKRTREENERCEKEIERLEDILRNEEIHNQSDTTHLQDDLQTLTTNVNKMANLGFAPHK KTVLKLPDFYGNYRTWPRFKLLFEETTRTEKFSNLENLTRLQIHLKGDALRSVSGLMLNPSNVDAILERL GRLYGNPVSIFNALLKDLMVVKRASLENPSSIIEFCNALNNMVENMTMLNQTEYLMDQRLLTDLVAKLSP DLKTRWLRDSLNEEGDKIKTLKDFSKWLKPTEDVAITLLAMEGGQRDRPARLNTHYSASHQISNKGCLIC SRPHETISCYKLKNASVNERWKMLKEKNVCTNCCKFSNHAAINCRSRPQCTVDGCGRRHNTILHEEKFNS MGAASKAHLNFHQNSEQYLFQVLPITVYNENNSIETFALIDPGSSTSLMTESLRQKLNLHGPRKPLTLSW TNGCNQVEDTSTSVSLKLRGPNGRLLYVKDIRTVKELDLPTQSINANVLKRKFSHLKTVNISSYKNAKPT ILLGLPHAYYTQAVESKSGAPNEPVAHKTRIGWVVFGKCRDGDAKENQHLFTIQDKKEEEEKSMRDLMKR FFSTEEFGVRETKFTPKSKDHERALSVMNDTLKYTNNQYEIGLLWKDPNVSLPSSYAQALRRLESQERKM KGNDEMKTWYKNQITDYVQKGYARKLTPFELLNRDPKINYIPHFMVINPNKPTPKPRLVFDAAAKNEGIS LNSTLLSGPDATTSIFGVLIRFREYPIACSGDIKEMFHQIRIRKEDQVAQRFLFRDNPRNEPQVYVMNVM TFGATCSPACAQFVKNENALKYKDKYPTAVEAIVKNHYVDDYLDSFRTINDAIKTINEVCLIHDRAHFFM RNFVSNCQEVIRSIPDDRSSQQELLHISNKDMNFEKILGQYWDKTNDVLRYKLKHTPCSIISKREMLAYL MKIYDPLGLAANYTTQAKVIIQEIWKTELDWDSPVPERIMEQWQRWKERIKELEHIQIPRCYSVASNIEV TELHTFVDASEKAFAAVVYLRTLTEKGIDVNIVAAKTRVAPIKPLSIPKLELQAAVLGVRLAETVKEELR ITTDRDYYWSDSKTVLGWINADPQKYKQFVAVRIGEILDTTNASQWKWVSSESNPADEATKVVTRKSIWL NGPVFLKQREIEYRDPKLIITHEEIRPNLMIKTIEKRTFNFIKTEWCSNWLRLKRSLAINLKYIEFLKSK VKRLAFSPIVEKENLDKAEKLLLQKAQWEIYEDDLVQLSLNGQVSKNSTIKNLNPQVIEGLLRARGRLAN ICYLSDDVKQPIILPKRHHVTELIIQHYHERYMHKKMEAVIAAIRQRFWVIDLRAVVRSVISKCQRCKNE RARPIAPMMAPLPESRAAVFKKPFTHTGVDYFGPMTVSIGRRVEKRWGAIFTCMTTRAIHLEIAKDLSTN SFIMCLKNVQHRRGKICHIYSDNGTNFVGANRQITELVERCATNGIKWHFNPPAAPHFGGVWERMVREVK SLLPNNDNMPEEVLRSAFIEIEFILNNRPLTHIPLETEDDEPLTPFHFLIGCSGEAEPTPAGISAAEASR NNWKKAQVITQNYWERWLKEYLPTLAKREKWIERSDPIQPDDIVVFPDEQRVGRWLKGRVVEVYPAKDGQ VRSAKIKVENGEYKRPVINLSVLEVKGKKIADVPSWGVKRPVNIAYVKKLAEQLKTPPAKRRKHLVKPYN GPVSMHYKPVSRMETNRQSFS
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute