Repbase Reports

2003, Volume 3, Issue 12
December 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 213

Mariner-5_AN

DNA transposon. Mariner superfamily. Tc1 clade - a consensus sequence.

Submitted:
31-Dec-2003
Accepted:
31-Dec-2003
Key Words:
DNA transposon; Mariner superfamily; Tc1 clade; Mariner-5_AN
Source:
consensus
Organism:
Emericella nidulans (Aspergillus nidulans)
Taxonomy:
cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiales; Trichocomaceae; Emericella
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Mariner-5_AN, a family of nonautonomous DNA transposons in the Aspergillus nidulans genome.
Journal:
Repbase Reports 3:(12) p. 213 (2003)
Abstract:
DNA transposon. Mariner superfamily. Tc1 clade. TA target site duplication. 40-bp TIRs. The 350-aa Mariner-5_ANp transposase is encoded by a single ORF (pos. 159-1208). The transposase is closest to the Impala transposase found in Fusarium oxysporum (GenBank AAB33090, 49% identity). Mariner-5_ANp: MGRRGKELTPDIRARLCELKAIGWTFAMIHQRYPHIPYSTIRNTIKRENDRKDQKSSPQSGRPKKISLEE QRHLLALIEQDHHIKMRKLSEAVQSSPSVRTVQRLFHTLHIQKWKQCERPEITPENAEKQLRWAETYAGY TAEDFNRVIWSDECLVERGAGIRRIYTFRSPRQQIIKRDVHAIRCGKGVKQMFWAAFGFNRRTGLLPLDG DPDAARGGVTAWVIRGVYKSFLPDILGPGDIFMHDGASVHRAYIVQQLLEDMGVEVMVWPPYSPDLNPIK NLWALMKAKIYELHPELERAPDTEETLQLLIKAAIEAWHAIDERVLQNLCHTMPHRVQAILRADGWYTSY
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2023 - Genetic Information Research Institute