Repbase Reports

2003, Volume 3, Issue 12
December 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 212

Mariner-4_AN

DNA transposon. Mariner superfamily. Tc1 clade.

Submitted:
31-Dec-2003
Accepted:
31-Dec-2003
Key Words:
DNA transposon; transposase; Mariner superfamily; Tc1 clade; Mariner-4_AN
Source:
consensus
Organism:
Emericella nidulans (Aspergillus nidulans)
Taxonomy:
cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiales; Trichocomaceae; Emericella
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Mariner-4_AN, a family of nonautonomous DNA transposons in the Aspergillus nidulans genome.
Journal:
Repbase Reports 3:(12) p. 212 (2003)
Abstract:
DNA transposon. Mariner superfamily. Tc1 clade. The consensus sequence was built based on multiple alignment of several copies 99% identical the consensus. Mariner-4_AN elements are characterized by TA target site duplications and 36-bp TIRs. It encodes a 449-aa Mariner-4_ANp transposase (2 exons, pos. 277-1149, 1205-1681). This family is closely related to Mariner-4_AN. The consensus sequences are 68% identical to each other. Mariner-4_ANp: MPAPHPNELRVQVLSYWALGIQPPDIAKMLQINVRTIRDMIQKGQDRGYNPAQCMRVKLE YVEDGKRSGRPKEISEATDMAVLASVKQDRNGREKSSEILAFEAGISHSSVLQILHKHGF TIVKPSWKPGLTEAAKATRLRFCLDHQHWTLEDWKAVIFTDETSVILGHRRGSVRVWRTA RDVHDPTCIRRRWKGSSDFLVWGCFTYDKKGPLHIFEPETAYQHKKSEVEIAALNAELEP ILREEWEIETRLKRLHLRGVPGRVPTWRFTEKTGKLVRKSKGGVDWWRYQQEILLPHLIP FAKACKIERPDTKVLEDGAPAHKHHAQRRIYSIHEIEKIFDWPGNSPDLNAIEPCWMWMK KRTTSRGAPRDKKTGKTAWIKAWNELPQEKIQGWIERLIRHIQEVIQHDGGNEYKEGRTD HDARSWKGRRIKGQLSARQDLSPDPWEDL
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2023 - Genetic Information Research Institute