Repbase Reports

2003, Volume 3, Issue 12
December 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 211

Mariner-3a_AN

Mariner-3a_AN is a subfamily of Mariner-3_AN - a consensus sequence.

Submitted:
31-Dec-2003
Accepted:
31-Dec-2003
Key Words:
DNA transposon; transposase; Mariner superfamily; Pogo clade; Mariner-3_AN; Mariner-3a_AN
Source:
consensus
Organism:
Emericella nidulans (Aspergillus nidulans)
Taxonomy:
cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiales; Trichocomaceae; Emericella
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Mariner-3_AN, a family of nonautonomous DNA transposons in the Aspergillus nidulans genome.
Journal:
Repbase Reports 3:(12) p. 211 (2003)
Abstract:
It is a subfamily of Mariner-3_AN. This subfamily is characterized by the TA TSDs and 15-bp TIRs. The 524-aa Mariner-3a_AN transposase is encoded by a single ORF (pos. 194-1765). The Mariner-3a_AN and Mariner-3_AN consensus sequences are 89% identical to each other. The Mariner-3a_AN consensus sequence was reconstructed based on multiple alignment of 3 copies ~1% divergent from the consensus. Mariner-3a_ANp: MAPPKRLSDVQRKALRDWVHSQSRRPTQKACIAWFQAHYNHRLSQSTVSDILSPQYHYLDSECNPSSATR KGIGQWQDLEAILYEWHHTLDCKGAYISGDILIEKARQIWSSLSQYRDQPPPAFSSGWLHRFKQRYNIKQ RTYHGEAGSVPEDVEEEMKAIRTIAGQYNEDDIYNMDETGLFWRMPPSQSLSSVNRPGIRKDKTRISMIC CVNASGTDRLPIWVIGKAHKPRALRNINISAIGIRWQWNKNAWMNQIIMREWLLEFYQHIGQRSILLTMD NLPAHLSGLELAPPPPNIRICWLPKNSTSRYQPLDQGIIQNLKIYYRKQWLRYMLSHYERDLDPLESVTI LDCIRWLVRSWHHDVLSSTILACFYKSTLVPDPIQLPVEAPDLKPLYEKVQQSGNLSDCMDISFFLNPAE ESQEPTSSSNGMSSEVLLEQLITEASGSTDIYSDDLDDDTAEPAPLPKPQDALDAVRLLISYMEGQDASK APILRSLERLERDLEGEIITARAQGTLDSWLSNA
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2023 - Genetic Information Research Institute