Repbase Reports

2003, Volume 3, Issue 11
November 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 199

copia-2-I_AN

Internal portion of copia-2_AN LTR retrotransposon - a consensus sequence.

Submitted:
30-Nov-2003
Accepted:
30-Nov-2003
Key Words:
LTR retrotransposon; internal portion; copia superfamily; copia-2-LTR_AN; copia-2-I_AN
Source:
consensus
Organism:
Emericella nidulans (Aspergillus nidulans)
Taxonomy:
cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiales; Trichocomaceae; Emericella
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
copia-2_AN, a family of copia LTR retrotransposons in the Aspergillus nidulans genome.
Journal:
Repbase Reports 3:(11) p. 199 (2003)
Abstract:
The 1412-aa copia2_AN-Ip polyprotein is encoded by ORF1 (pos. 187-4422). copia2_AN-Ip: MPPKASRGTKSNDVPFQMTTRHRTYEPETPVSADNQISNDSTDEDQPDEPTTMEDMRAGLLRQLRDELRE ELREEMAQQLRSEIRHEIRAEQQHQSPTQQLHQEINQNASYGRNTDIQQRDLIYCEKQDIRKLAKSKFGT QASILLNGRSNYTAWRDSMLMDTYMIEAKDILDETKPPDGSNEIDIARWETKNEILHTRILQSTARHVRQ TISWKGSTLASELWARITSTYGLSMAEERLMTVKALLDINPQGNYPAMVRDFQRIAAKIKEMKLSLDDVI HDIFICSLGQWQQNFVRTKLDEFYSCGRGPIKNLDIDTFADQLVARSSSSNNKYIPQEPQEFKLEPRYRI ILTEPKDSSRTKRDGQDQKPARTKTLCQACGKGYHKPDDCWTLHPEKAPKRHGNQASGTSNDNKNQQPTG QELVLRNHPQANSIAIVPAKEPENDEEPQWLLDTAAAFHISNKYHVFINLRGHKAYINDAGGRTHQIIGI GTALVYGVEIPDVRYAPTTTADLLSFSQLDDQDFDVSTQGTVNKKHFYITSPTGASLDAFKEQNTCLYQI KPVAYAIQPILHAKDTQKETNNIIPTATMEEWHQHLSHVHLQAILKMAQQKIIKIKGPKTLAFCDICRQA KERRKSTKEPASRATKILVRIYIDIAGGGAILDCKDKQAPPGIRNIRYFLLITDDATQYQWVYTLRTRDE AIPTFQGWLEHIKNQGYSPPAFVRSDREFLTEHVKKLCQTYGLIWEPTAADSPWQDGVSERGIQTVLQYT RAMLYDSGLPRWLWPQALQTAVYHMNRLPTRVPLYNDRRPMAPTSDPEIQPCAHFTPYSAWTNGDTDIKH LVKFGSPAWMHLHGASKYAGKPTSKIDPKAKKVHVVGYQGRHIYVIWDPEINQLRDTSDISIKEEFNPPQ SKPYEAAKAPEAAKALETVKPGETAEAAEPKTNEDLLIQDISDITSREELYRPAKGFAIQKSVESPLPEP KSYNEAIKGPESAQWHAAMQEEINTLKQKQCWDLIRKSDMPAGARAIPGRWVYKKKLNPDNSIRYKAQWV IRGNLLDKSEFEGATYAPVVDPITSRILFGVSAQKGWHIIQADAVLAFLNAKLKGQPIYMHQPLGFAEGE PGTLVCLLRQSLYGLTPSARLWYDDLRAYLESIGFKVSPHDPGLFVHVTEKLYITTHVDDFMIVGEKAQN AVQALESLKSRFEIKEAPEFKRYLGMNIKTTPTGIHLSQEDQIDDIINSFRLHNAHPTKSPLDPGTVIDD APDPKINIKEYQHGTGSLQYLATKTRPDISRAACFLAEFNTAPTAKCWAALIHIIKYLKGTRSLGIRYQH DPAANIKPPKAFSDSDWGGPHTKARRSVGRYVFKLAGGPIAWQSKRQTCVATSSNEAEYIAASEASREAY WIYSPQTSKDRQKFIKIQRLAKL
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2023 - Genetic Information Research Institute