Repbase Reports |
|---|
| 2003, Volume 3, Issue 11 |
| November 30, 2003 |
| Copyright © 2001-2016 - Genetic Information Research Institute |
| ISSN# 1534-830X |
| Page 196 |
Mariner-3_AN |
|||
|---|---|---|---|
DNA transposon, Mariner superfamily, Pogo clade - a consensus sequence. |
|||
|
Submitted: 30-Nov-2003 |
Accepted: 30-Nov-2003 |
||
|
Key Words: DNA transposon; transposase; Mariner superfamily; Pogo clade; Mariner-3a_AN; Mariner-3_AN |
|||
|
Source: consensus |
Organism: Emericella nidulans (Aspergillus nidulans) |
Taxonomy: cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiales; Trichocomaceae; Emericella |
|
| [1] |
Authors: Kapitonov,V.V. and Jurka,J. |
||
|
Title: Mariner-3_AN, a family of DNA transposons in the Aspergillus nidulans genome. |
|||
|
Journal: Repbase Reports 3:(11) p. 196 (2003) |
|||
Abstract: DNA transposon. Mariner superfamily. Pogo clade. The consensus sequence was reconstructed based on multiple alignment of 3 copies that are ~98% identical to each other. Mariner-3_AN elements are characterized by TA target-site duplications and 13-bp TIRs. The 525-aa Mariner-3_AN transposase is encoded by a single ORF (pos. 185-1759). The Mariner-3_AN transposase is most similar to the CENP-B homologue protein 2 (CBHP-2) from Schizosaccharomyces pombe. Most likely, CBHP-2 is also a transposase rather than a protein involved in a mitotic function (Irelan, J.T. et al., Genetics 157:1191-1203,2001). Mariner-3_ANp: MAPPKKLSDVQRKALRDWVHSQSPRPTQKACIAWFQSRYNHRLSQSTVSDILSQQYQYLDSECNPSSATR KGIGQWQDLEAILYEWHHILDCKGAYITGDILIEKARQIWSSLPQYRDQPLPAFSSGWLHRFKTRYNIKQ RTYHGEAGSVQEEAEKEMKAIHIFAGKYNEEDIYNMDETGLFWRMPPLQSLSSINRPGIRKDKSRISIIC CVNASGSDRLPLWVIGNARTPRALRNINISAIGIRWQWNKKAWMNQIIMREWLLDFYQHIGQRSVLLAMD NLPAHLSGLELAPPPPNVRICWLPKNSTSRFQPLDQGIIQNLKIYYRKQWLRYMLSYYERNLDPLQSVTI LDCIRWLVRAWHHDVQSSTILACFYKSTLVQDPIELPVEAPDLRPLYTQVQQSGRLSDCMDISFFLNPAE ESPEPISSGNEISSDALLEQLIAEASGNADIYPNNLDDDSGEPAPLPKPQDALDAVRLLISYMEGQDTSK TPILRSLERLERDIEGEIITAKAQGTLDSWLSNAR
|
|||
|
Derived: [1] (Consensus) |
|||
|
Download Sequence - Format: IG, EMBL, FASTA |
|||
|
References: |
|||