Repbase Reports

2003, Volume 3, Issue 11
November 30, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 195

Mariner-2_AN

DNA transposon, Mariner superfamily, Tc1 clade - a consensus sequence.

Submitted:
30-Nov-2003
Accepted:
30-Nov-2003
Key Words:
DNA transposon; transposase; Mariner superfamily; Tc1 clade; Mariner-2_AN
Source:
consensus
Organism:
Emericella nidulans (Aspergillus nidulans)
Taxonomy:
cellular organisms; Eukaryota; Fungi/Metazoa group; Fungi; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiales; Trichocomaceae; Emericella
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Mariner-2_AN, a family of nonautonomous DNA transposons in the Aspergillus nidulans genome.
Journal:
Repbase Reports 3:(11) p. 195 (2003)
Abstract:
DNA transposon. Mariner superfamily. Tc1 clade. The consensus sequence was reconstructed based on multiple alignment of 3 copies. They are 99% identical to the consensus. Mariner-2_AN elements are characterized by TA target site duplications and 37-bp TIRs. It encodes a 393-aa Mariner-2_ANp transposase (2 exons, pos. 291-1116, 1318-1673). The transposase is closest to mariner/tc1 transposases from frog and fly (GenBank, AAP49009.1 and CAA82359, respectively). Mariner-2_ANp: MPRGGFHPVELRVQVLTLSAIGFSTEKISKSLNLSPRTVQSIVKKGRDRGYRPEVSLRVQ LEFVEDRKRSGRPVEITEATQNTVITSVTADRAGREKLSEILAYEAGISHSSVLCILHSH GFVIAKPSWKPGLTEAACLRRLEFCLAHQHWTLEDWKRVIFTDETGVILGHRRGAIRVWR TVKDSHTRNCVRRRWKACSDFMVWGCFSYNKKGPLHIYKPETAAMRKQADIEIEAMNREL EPLCREEWELATGLSRVHLRPNRGRVPKWNWNEKNEDSAPAHCHRIQQHVYKAEDVQKIL DWPGNSPDLNAIEPCWAWMKKRTTSRGAPRDKKTGEAEWRQAWADLPQETIQHWIERLIR HIQIVIELEGGNEYKEGREDRDTRSWAGRRIKG
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2023 - Genetic Information Research Institute