Repbase Reports

2003, Volume 3, Issue 10
October 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 187

Penelope1_CI

Penelope-like non-LTR retrotransposon - a consensus.

Submitted:
31-Oct-2003
Accepted:
31-Oct-2003
Key Words:
non-LTR retrotransposon, Penelope superfamily; reverse transcriptase; Penelope1_CI
Source:
consensus
Organism:
Ciona intestinalis
Taxonomy:
Eukaryota; Metazoa; Chordata; Urochordata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
Penelope1_CI, a family of Penelope-like non-LTR retrotransposons from the sea squirt Ciona intestinalis.
Journal:
Repbase Reports 3:(10) p. 187 (2003)
Abstract:
Penelope1_CI is a family of non-LTR retrotransposons from the Penelope superfamily. Penelope1_CI encodes a 604-aa Penelope1_CIp reverse transcriptase (pos. 1-2531, conceptual translation). Penelope1_CI retrotransposons usually are 5' truncated. Therefore, the consensus sequence is incomplete at its 5' end. Penelope1_CI is represented in the genome by approximately 1000 ~1kbp long 3'-end copies. They are 5% divergent from the consensus sequence. The ~200-bp 3'-terminus is often repeated and forms a palindromic structure. Penelope1_CIp: MAWQIESSTGETLSNKDWVMNMSDKELTPAQSVLSLGLNFAVSPDNVPWKQIVASIEKGLVGQPLHIKSL LQSKLVGCIRSHKTTTTNVPKSYLAAIRELQXKDRSIVILSADKGNRAVVMNRTDYTAKLLELMKDARTY KKLARNPTPSLERKVNNYVXRLHREREVLSYSEFRQLHCTDGRTPQLYGLPKVHKPDIPLRAIVSFIGSP SYMLAKFLAKIVAPLIGNNSHHVRNSHEFAAEVRDMTIADGECLVSFDVVSLFTNVPIPLAMLVSGCVLT LHVLRFRVHSTNKCFGTAMGGSPISVVIANVVIETIEEDALATFMHPPRYWKRYVDDTFAIIAAEQLHPF LGIEESIQFTLERENEGKIAFLDVEVSRDEEGGMKTYVYRKPTHTNRYLSFWSAHPIEHKKAVVRSLKHR AEALVSDPLRLQDEMKFIKDGLRYNSYPPWMVKWKPTQKPKEVTPTIATLSLPYVPGLSDTLKRECLPIT VLRFNSKPHTTLRSLLSHPVENQATEPKGVVYLIPCGDCEEGVYIGETGRALKTRLKEHRRDVAAKDASK TALSKHSAVCNHRVAFENVQILERETDLTKRLFLETLHIHKHRECVNNKEQCTYFPTVYNNLI
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute