Repbase Reports

2003, Volume 3, Issue 10
October 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 184

HARBINGER3_DR

Autonomous Harbinger-like DNA transposon - a consensus.

Submitted:
31-Oct-2003
Accepted:
31-Oct-2003
Key Words:
DNA transposon; Harbinger superfamily; transposase; DNA-binding protein; HARBINGER3N_DR; HARBINGER3_DR
Source:
consensus
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
HARBINGER3_DR, an autonomous Harbinger-like DNA transposon from zebrafish.
Journal:
Repbase Reports 3:(10) p. 184 (2003)
Abstract:
HARBINGER3_DR is an autonomous Harbinger-like DNA transposon. The consensus sequence was built based on several copies that are 90% identical to each other. This transposon is characterized by the 3-bp target site duplications and 12-bp terminal inverted repeats. Protein machinery encoded by HARBINGER3_DR was involved in transpositions of HARBINGER3N_DR nonautonomous elements. HARBINGER3_DR encodes two proteins, 343-aa HARBINGER3_DR-1p (2 exons, positions 368-1037 and 1119-1480) and 221-aa HARBINGER3_DR-2p (2 exons, positions 3345-2940, 1762-1503). HARBINGER3_DR-1p is a Harbinger DNA transposase. HARBINGER3_DR-1p: MAVLALLEDIVNGRIRRERVFRDHGDFLAHDDDWLISRFRFPRAILLDLCAELGPLLERE TARSHALPVPLQVLTTLGFLATGSFQRELADRSGLSQSSLSRAMPAVWDGIIRMSSRYIR FPYHAVDQPNIKAQFAAIAGFPNVIGAIDCTHIAIKAPSEDEFAYVNRKHFHSINVQIIC DAQMRLTNIVARWPGSTHDSFILTNSMVGMRLQGGRVRDGWLLGDRGYPLKTWLLTPLNN PQTDQERRYNDAHSHTRSVVERAIGQLKCRWRCLDKSGGVLLYRPNKVCRIVLACGVLHN VAHRHGIPNGEPVAPPDDPDPGPVCIQPNQQAIQARQRVVAAI HARBINGER3_DR-2p is a DNA-binding protein that contains the myb/trihelix motif. HARBINGER3_DR-2p: MAKANKKRNFTECELEVLLSEVDRRKTVLFASLSSGINNKRKKIEWESLADAVNAVGSER RTVSELKKKWSDVKVQVKRRTAAHRQSVDRTGGGTGDTALTPFEERVASIVGDTLLSGVV SVSVGDTDVLEEAHEDGAGTSTDTDFVPPEEPEPSVSGATPRVSSASASAEARPSGRVLT QAVLESQQDIVRAIGDINNHLKNISNALTDISQSLKELVKK
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute