Repbase Reports

2003, Volume 3, Issue 10
October 31, 2003
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 182

ATIS112A

ATIS112A is an autonomous DNA transposon.

Submitted:
01-Feb-2001
Accepted:
01-FEB-2001
Key Words:
autonomous DNA transposon; 3 bp-long target-site duplication; transposase; TIR; Harbinger superfamily; ATIS112A
Source:
consensus
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Plantae; Embryobionta; Magnoliophyta; Magnoliopsida; Dilleniidae; Capparales; Brassicaceae
[2] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
ATIS112A is an autonomous DNA transposon.
Journal:
Repbase Reports 3:(10) p. 182 (2003)
Abstract:
ATIS112A is an autonomous DNA transposon. There are several copies of the transposon in the A.thaliana genome which are more than 90% identical to each other. They are bordered by 3 bp-long target site duplications. ATIS112A has 25 bp-long terminal inverted repeat. ATIS112A encodes two proteins, ATIS112A-1p and ATIS112A-2p. The 320-aa ATIS112A-1p is a putative DNA binding protein that includes the SANT/myb/trihelix motif. The protein is encoded by 3 exons (834-922, 1262-1444 and 1498-2188). ATIS112A-1p: VIWRICNKVCCFLIEYNPNAKVVGLRSNASFINLLNSQDDSHILPPNPYECFELGSANVP VYSTEWSDDDPSEDEAPIAGKKGRKGRKGRNGWLNTSKDPVVGNEQKGAAFWERIAAYYN SSPKLKGVEKRGHICCKQRWSKVNDVVNKFVGSYLAASKQQTSGQNDDDVVSLAHQIFSK DYGCKFTCEHAWRELRYDQKWIAQSTHGKAKRRKCEDDSEPVGLEDKEARPIGVKAAKAA AKAKGKGKLSPDEGEETNALKEIKSIWEIKEKDHAAKEKLIIIKEKKNRTKLLERLLGKT EPLSDIEIELKNKLINELLA ATIS112A-2p is a 484-aa Harbinger-like DNA transposase, which is related to the transposase encoded by the bacterial IS112/IS5 transposons (pos. 3583-5034). ATIS112A-2p: MAGSSSNYNLDDMFDDKFDQCFDQALESYGNRQRVKPRKKKAYIERNREEGHIQLVNDYFTENPTYPPHI FRRRFRMNKPLFMRIVERFSNEVPYFKQRRDATGRLGFSALQKSTAAIRMLAYGIAADAVDEYLRIGEST SLLCLEHFAEGIINLFGDEYLRRPTRDDLIRLLHIGEQRGFPGMIGSIDCMHWEWKNCPTAWKGQYTRGS GKPTIVLEAVASQDLWIWHAFFGPPGTLNDINVLDRSPVFDDILQGRAPKVKYVVNGKDYNLAYYLTDGI YPKWATFIQSISIPQGDKASLFATTQEACRKDVERAFGVLQARFAIVKHPALFHDKVKIGNIMRACIILH NMIVEDERDGYTQFDVSEFVHPESASSSQVDFTYATDMPSNLGNMMATRARVRDRIKHEELKADLVEHVW There are several other highly divergent families of Harbingers present in the A. thaliana genome [1]. Originally, the transposon was described by [1]. The consensus sequence derived by [2] encodes the complete transposase.
Derived:
[2] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Kapitonov,V.V. and Jurka,J.
    Direct submission to Repbase Update (January 2001)

© 2001-2020 - Genetic Information Research Institute