Repbase Reports |
|---|
| 2002, Volume 2, Issue 7 |
| July 31, 2002 |
| Copyright © 2001-2016 - Genetic Information Research Institute |
| ISSN# 1534-830X |
| Page 29 |
L1-9_DR |
|||
|---|---|---|---|
L1-9_DR is a non-LTR retrotransposon from the L1 clade - a partial consensus. |
|||
|
Submitted: 31-Jul-2002 |
Accepted: 31-Jul-2002 |
||
|
Key Words: Non-LTR retrotransposon; endonuclease; reverse transcriptase; L1 clade; ORF2; L1-9_DR |
|||
|
Source: consensus |
Organism: Danio rerio |
Taxonomy: Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio |
|
| [1] |
Authors: Kapitonov,V.V. and Jurka,J. |
||
|
Title: L1-9_DR, an ancient family of non-LTR L1-like retrotransposons from zebrafish. |
|||
|
Journal: Repbase Reports 2:(7) p. 29 (2002) |
|||
Abstract: L1-9_DR is an ancient family of L1-like non-LTR retrotransposon. There are ~500 copies of L1-9_DR in the zebrafish genome. They are ~7% divergent from the consensus sequence. The consensus sequence is incomplete and represents the 3' end od L1-9_DR. It encodes the C-end of the ORF2 protein (L1-9_DR2p). L1-9_DR2p: TPICYNHAFKPSLTDKVFEQWQDKPVFSVTDLYINNIFATFSQLSEKFNLPPSNCFRYLQVRNYVRLNTP DFEVLSLEGELFDLFLNSSNARGLTSLFVNAFKNKANCSSLHLKVALEEDSGISTSETDWDQCLLSVYSC SRHHLIQYKVLHRLHYSKTKLDKFYPSVSPTCDKCKAAEGTLHLFRSCVQIQNFWLEIFQFFAKVYDCVL LPDPMIAIFGWSDFLETLNRNVRLPVQYGMIIAKKVILCFWKKNVRPLFF
|
|||
|
Derived: [1] Consensus |
|||
|
Download Sequence - Format: IG, EMBL, FASTA |
|||
|
References: |
|||