Repbase Reports

2002, Volume 2, Issue 5
May 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 29

REX1-1_DR

REX1-1_DR is a CR1-like non-LTR retrotransposon - a consensus.

Submitted:
31-May-2002
Accepted:
31-May-2002
Key Words:
non-LTR retrotransposon; CR1 clade; REX1 subclade ORF2; AP endonuclease; reverse transcriptase; REX1-1_DR
Source:
consensus
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
REX1-1_DR, a family of CR1-like non-LTR retrotransposons in zebrafish.
Journal:
Repbase Reports 2:(5) p. 29 (2002)
Abstract:
REX1-1_DR is a family of CR1-like non-LTR retrotransposons and it was active in zebrafish a few million years ago. The consensus sequence encodes one protein, REX1-1_DR1p (position 723-3311). The 863-aa REX1-1_DR1p protein is composed of the AP endonuclease (positions 1-200) and reverse transcriptase. REX1-1_DR copies are ~9% divergent from the consensus sequence. Approximately 1000 copies of REX1-1_DR are present in the zebrafish genome. REX1-1_DR1p: HGRLKAKLKLIPHRLSLPSIFLANVQSLVNKMDEIRLRINHSKRLWNCNVMIFTETWLNSGIPDNAVFLT EHNTFRADRTADDFDQRHCSANLEFLMVKCRPFYLPREFTFTIVTAAYIPPDADAKLVMNELPAISKQQT AHPEATFIVAEDFNHSNLKTVLPKIHQKDFCHKSGNKTLDHVHTNMAEAYVMNPPPPLGSIRSPFLFLTP KYSLLINRVKPSVRTIKVWPAGVDSTLQDRFQHTDWSIFASQANYGPYIDIISYTSSVLEYITTAIDSVT TQKQISTYPNQKPWMNKEVCLLLKARNTAFRSGDAQAYSTSRANLKRGIKKAKHCYKLKLEEHFSNSDPR CMWQGIQAISNYKPSQTTSTATNVSFLNELNDFYARFESDNKEAYTRITSSTDHSPITLTSSEVYTALSQ INVCKAAGPDGIPGHVLKACAEQLAGVFTDIFNLSLNLAAVPTCFKTTSIVPVPKHCSPTCLNDYRPVAL TPIIMKCFERLVLAHLKDSLPSTLDPHQFAYRGNRSTEDADSIALHSVLTHLDNKNIYARMLFVDFRSAF NTVIPSKLMIKLRDLDIDTSLCNWVMDFLTNRPQNVRSGHICSTTVTLNTGVPQGCVLSPFLYSLFTINC RPVNRSNTIIKFADDTTVIGLISNNDETAYREEIQHLATWCTDNNLLLNTNKTKELIVDFRKGRTGSHDP IHINGMAVEPVSSFKFLGTHISKDLSWTTNTSSLVKKAHQRLFFLRQLKKNQLSSAVLVNFYRCTIESIL TNCVTVWYGSCSVAERKALQRVVKTAQRITGTTLPAIEDIQKKHCLRRARSILKDTSHPAHRLFSLLLSG RRFRLPRTKTSRLRNSFFPRAPF
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2023 - Genetic Information Research Institute