Repbase Reports

2002, Volume 2, Issue 5
May 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 22

HAT1_DR

HAT1_DR is an autonomous hAT-like DNA transposon.

Submitted:
31-May-2002
Accepted:
31-May-2002
Key Words:
DNA transposon; hAT superfamily; transposase; HAT1N_DR; HAT1_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
HAT1_DR, an autonomous hAT-like DNA transposon from zebrafish.
Journal:
Repbase Reports 2:(5) p. 22 (2002)
Abstract:
HAT1_DR is an autonomous hAT-like DNA transposon. It is flanked by a 8-bp TSD. This element encodes a 597-aa transposase, HAT1_DRp. HAT1_DRp is encoded by 4 exons (ORF positions 654-881, 1152-2111, 2205-2390, 2487-2894). The zebrafish genome harbors subfamilies of nonautonomous DNA transposons that are derivates of autonomous elements similar to HAT1_DR. HAT1N_DR is one of these subfamilies; its consensus sequence shares ~85% identical 238-bp and 138-bp termini with HAT1_DR. HAT1_DR and HATN1_DR elements had imperfect 9-bp terminal inverted repeats (1 mismatch) at the time of their transposition in the past. HARB1DRp1: MDAPRKRCRPSVVWEHFHLETPNKVRCMYCDRQLAYCNNTSSMMRHLRSTHPAILGGAED GPVPRPASHTAGSSKQGRQKELDEALVDMVVKDLQPFTIVEDMGFRAFVNKLDPSYVLPS RKALKTMVMEKYNSTKEKIMGDIQKAQFVSLTADMWSSINMDGYLDVTCHFITPEAKMAT VVLGVVRFYQTHTAQHLMEAKTLLMSEWGITSKVQCLVTDNASNMMLSAQLLHLRHIPCF AHNLNLIVKKALDQTPLVSEIRQKARKIVGLFRSSCKAKDKLEEMQTLMGRPTLKLIQEV ETRWNSTYDMLQRLFEQREPVAAAISSLKADTALLSSMEYDVVQEAMSLLQPFKLATTEL SEEQRVSASKLIPLYRMLQHKLTEKKGLAKQESVVQLGSHLQEGLQSRCGGYESFRTLAL ATLLDPRFKTVAFGNTGKGQEAERHLTMECASLMRNQTSHDPQLSASMPSSSSSSSSSSS STTPAESQDSLWELFDNRVRESNLTSSVTADATVEVKKYITDAFLPRNEDPLKYWKEREN IFPNLYVLAQKYLCMPATSVPCERIFSKAGEIICKKRSRPSPSTAEHLIFLNKNLYL
Derived:
Positions 79447 82738 Accession No AL603743 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2023 - Genetic Information Research Institute