Repbase Reports

2002, Volume 2, Issue 5
May 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 6

CR1-4_DR

CR1-4_DR is a CR1-like non-LTR retrotransposon - a consensus.

Submitted:
31-May-2002
Accepted:
31-May-2002
Key Words:
non-LTR retrotransposon; CR1 clad; ORF2; reverse transcriptase; CR1-4_DR
Source:
consensus
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
CR1-4_DR, a family of CR1-like non-LTR retrotransposons in zebrafish.
Journal:
Repbase Reports 2:(5) p. 6 (2002)
Abstract:
CR1-4_DR is a family of CR1-like non-LTR retrotransposons and it was active in zebrafish recently. CR1-4_DR copies are ~5% divergent from the consensus sequence. There are ~100 copies of CR1-4_DR present in the zebrafish genome. The 5' portion is incomplete; the consensus was built from five copies. The consensus encodes CR1-4_DRp, a 566-aa portion of the reverse transcriptase. CR1-4_DRp (positions 2-1696): XLCNSFLTFFETKIKNIHHQLHSNSSAPDFSQHVSEIITHFSFDTFTLPSTAEIVGHIRKSKTTNCLLDP LPTCLVKTCLPSLSTLITNIIHKSLDSGSVPSLFKTAVITPVLKNLELIHPIWPTTDQFPNLPFVSKILE KCVASQIHNYLSINNLFELFQSGFRPNHSTETALVRITNDLLLAADSGLLSILILLDLSAAFDMVLHEVL LNRLASLGISGTLLLWFKSYLEDRTQYVQIKDFKSRSQIVTTGVPQGSVLGPLLFIIYLLPLGHIFRKYN IQFHCYADNTQLYLSTKPSCSFPPSALSRCLAEIKIWLSANFLKLNSDKTEALLIGTKSVLDKADNFTID IDNSTIFPSVQVKSLGVILDSTLSFEGHINNITRTAYFHVRNITRLRPSLTTNNTAIFIHALVTSRLDYC NALLSGLPSKLLRQKLQLVQNHAARVISRTPSHEHVTPLLYQLHWLPVKYRIDFKILLLTFKALHNLAPQ YLTELLHIYTPSRTLRSANNFTLVPPRTRLSTMGDRSFSSMAPRLWNSLPLDLRSSDSLHTFKSRLKTHL FKQAFL There is only a ~60% identity between CR1-4_DR and other CR1-like elements from zebrafish.
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2023 - Genetic Information Research Institute