Repbase Reports

2002, Volume 2, Issue 5
May 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 4

CATCH3I_DR

Internal sequence of the CATCH3_DR endogenous retrovirus.

Submitted:
31-May-2002
Accepted:
31-May-2002
Key Words:
Endogenous retrovirus; LTR retrotransposon; BELL/CATCH superfamily; CATCH3_DRp polyprotein; gag; protease; reverse transcriptase; endonuclease; CATCH3_DR; CATCH3LTR_DR; CATCH3I_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
CATCH3, an endogenous zebrafish retrovirus from the BEL/CATCH superfamily.
Journal:
Repbase Reports 2:(5) p. 4 (2002)
Abstract:
CATCH3I_DR is an internal portion of the CATCH3_DR endogenous retrovirus, which belongs to the BEL/CATCH superfamily. It is flanked by 99% identical long terminal repeats, deposited in Repbase as CATCH3LTR_DR. The 3' end of CATCH3LTR_DR and 5' end of CATCH3I_DR are not precisely defined. CATCH3I_DR encodes CATCH3_DRp, a 2007-aa polyprotein (positions 209-6229). CATCH3_DRp: MSLMNCDDDGATTCEQTETIVPFEKFETEHVREKRLIKLTPKALLEKLETLQKTRKCKLSKAKNLMAIIK DFMSNREYEKEVQCSFEKFIKLRDETKEMHNSVMVLLPSEEKEKQQTWFNGKMLICDEFVDDVEKWLSAE SQVSCSGVDARVCQEDVNPDDSISNISSCKSSKSSSKKSSSSVRSGRSSAASARIMAEAEKAALMARAAA LKEKHTLEVQQEKLRHRQEQLDIDAEIAAATAKIAVLNNQSLKTCTDDMNAYCDKGTVTLNPHAEAYVPI EVPLQESSRNVIQQIHSVPQIDPHFTSQMQSSSVMQNSDGIITSNLCSILQKQNEITTLLVQQQQSSTLP QRDIPVFDGNPLQYKTFMRAFEHGIEDKTKNSRDCLYFLEQYTQGQPREIVRSCQHMDAQRGYVQAKALL KEHYGNEFKIASAYVEKVLAWPSIKSEDVNSLQSYALFLRGCCNVMEEIDYMEELEMPSNLKTIIMKLPY KLRENWRTVACELMERRKQRARFKDIVIFVEHQVKMSSDPLFGDIQSTQPVQQKFQPKTKVRNSFATTVV TNNKSIQCCETDLRSKAPVVCLCCKRDHLLEQCTQMQNKLHKDKLNFLKEKGVCFGCFSFGHISKRCDKR LTCTVCGQKHPSILHIQQKERVCTQEQSHSSLSSAHVALTTCGQTGAGDDGDCALSIVPVQVKSSKGQTV IQTYAFLDPGSSTTFCSERLMHSLKLKGKETNIVLKTMGNQRAVNSTVLTGLEVSNLLDDTFYSLPEVFT QERMSVSRDNIVTQKDLENWPYLKGVEIPQIPADVDLLIGANASRVMEPWEVINSNGDGPYAVRTLLGWV VNGPLQGSRNKVKCSGVTVNRISVRKLEDMLGKQYNHDFNENSVEKKEMSREEHAFMEKVSKSIEFQDGH YKLNLPFRMEIPMLPNNLCVAKQRLIGLKRKFERNKIFHQEYKDFMDEVIKHGYAEIVPLHQLKQDEGKV WYIPHHGVYHPKKQTLRVVFDCGAAFKGTSLNDQLLQGPNLTNSLLGVLVRFRQEPIAFMADVKAMFHQV KVAEEDTDFLRFLWWPDGDINQDSVEYRMKVHLFGAVSSPSCACYALRRTAEDNKDDFPEKVIDTIHTNF YMDDCSKSVPSEEEAVLMIKDLTDVCLAGGFQLIKWISNSRIVLQSVPEEHRAQGIKMMDLDKDQLPMER ALGLWWCVESDTFNFKITSKDHPCTRRGVLSKVCSVYDPLGFLAPFTLTAKILLQELCRIRCGWDDLLPS NLQRQWSLWLKELEKMADFKMDRCLKPAGMDELTNVQLHHFADASTLGYGTVTYLRMETKQDVHVTFLLS KARVAPLKSVTIPRLELTAAVLAARVDKMLRAEMQFPLVDSVFWTDSTSVLKYIKNEDKRFLTFVANRIS AIREITTPLQWRYIPTTQNPADCCSRGLKADQLLTNREWINGPSYLWKPVEEWPAQIFDSALKADDPEVK RNICVNSTLVSEQSNATHRLITHFSDWTKLKVAVAWLLKLKTVLKQRSQKRKEIQASLDSSGVTSKKTEK ELRKLTGSVVTPNLSLQDVNEAEVAIVAFSQRQQFKKEIDALSVSPVSKISRDSKLYKLDPVYQDGILRV GGRLRNSAMPEERKHPIILAKDQHIATLILRHIHQQLGHSGRNYMLSELRKRYWIIKGNAAARRIISSCG HCRRFGVKVGEQKMADLPKERLLPDLPPFSNVGVDYFGPVEVKRGRSIVKRYGVIFTCMASRAVHLEVAY SLDTDSCINTLRRFICRRGQVTQIRSDNGTNFVAAEKELKESLRSWNQNKIQRAMLQKGVQWSFNPPGGS HYGGIWERVIRMVKIILNSILHQQILDDEGFHTVLCEIEAILNDRPITKLSDDPNDLESLTPNHLLQMKG KPVLPPGLFEKSELYSKRRWKQVQYMCDLFWKRWTNEYLPLLQDRQKWNKERRNFVPGDIVVIVDSSAPR GSWLMGRILEVFPDKNGLVRSVRVQTKTSVLERPVTKLCLLYDNMEI CATCH3_DRp is composed of gag-like, protease, reverse transcriptase, endonuclease domains similar to other retroviruses from the BEL/CATCH superfamily.
Derived:
Positions 46181 52553 Accession No AL590152 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute