Repbase Reports

2002, Volume 2, Issue 4
April 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 18

L1-1_DR

L1-1_DR is a non-LTR retrotransposon from the L1 clad.

Submitted:
30-Apr-2002
Accepted:
30-Apr-2002
Key Words:
Non-LTR retrotransposon; endonuclease; reverse transcriptase; L1 clad; L1-1_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
L1-1_DR, a non-LTR L1-like retrotransposon from zebrafish.
Journal:
Repbase Reports 2:(4) p. 18 (2002)
Abstract:
This element is characterized by 12-bp target site duplications. It can be an active element. It encodes two proteins: 294-aa L1-1_DR1p (positions 172-1053) and L1-1_DR2p (positions 1665-5489). These proteins are most close to corresponding proteins encoded by other L1-like elements. L1-1_DR1p is a putative RNA/DNA binding protein, and L1-1_DR2p is composed of the AP endonuclease (aa positions 1-200) and reverse transcriptase domains. L1-1_DR2p: MAGKLRKYKYTGKTAANQEDANTPSMMSEPAEHTDILEIKAELISSIKTEITSLFQKELKTALSNEFEMV KAELQAVKSEIASNASAVRSDLEAIKTTVSDMERGLSSCSDDVTELQNTVRKLEKNVVTLQEKCLDMEGR MRRSNIRILNVAEDPGACTPASVSKLLKDTLKMDKDILIDRSHRTLQAKRADGKPRAIVAKLHYYQDCVE ILRRVRETGPLHHNGATIFIFPDYPPSVARARSAFNEVRKLLRGKDGVRYGILHPARLRITHNGTEKQFQ DAAEALTYVKNNIL L1-1_DR2p: MVKPHNVNASGICQVNLISWNVKSLNHPVKRGKVLSHLKQLNTDIAFLQETHLKTFDHFRLRGGWVGQLF HSTFHSKSRGTAILISKTVSFEASKIEADPAGRYIMVVGRLNNTPVVMVNVYAPNWDDSAFFTGLFSRIP NIDTHHLILGGDINCVLSPSLDRSSLKPMIPSRTTQVINQLLKTYGMIDVWRFQNPGCRGYSFYSPVHKT YSRIDYFFLDSELLPLVSECKYNAIVISDHAPLLITLDMPITSNNYRPWRFNTLLLSDVEFVKFISSEIR EYLVHNQTPGISSSLIWESLKAYLRGQIISYSARLKKKQHERLKKIENDIFKLDEILAHSSTPDMFRQRL ALQSEFNLLCTKQTENLLIKSRHKMYEHGEKIGKILAHQLRQQNAAHSIMSVNDNTGTKLTNPLEINHRF REYYSQLYTSESCKDESLFDSFFKKISLPTIDQEFALDMENPFSKDEFIRAVSSMQNGKSPGPDGFPSEF FKKFSGELAPILLSLYEESSVTGSLPETMNQAIISLIYKKDKNPSECSSYRPISLLNVDSKIFAKILAHR LEIVLPTIVSGDQTGFIKNRYSFYNIRRLLNILHHPTPSDVPEVLLSLDAEKAFDRVEWDYLFYTLKKFG FGTKFISWIKILYSSPMAAIRTNCHISPFFSLERGTRQGCPLSPLLFALVIEPLSIAIRNDINIKGIQRD NFEHKISLYADDTLLYISEPLTTLPQIMTLLTAFGKISGYKINMQKSELMPINNAGRKIIFTSLPFKITK DKFKYLGIWITNKYKHLYKVNFPPLIDSIKKDLERWNPLPLSLGGRINTIKMNILPRCLYLFQCIPVFLT KSFFLLLDKLISSFIWNGKNARIRKNILQRHRDHGGLSLPNIQQYYWAANIRAMLHWSNPSYDSGPNWLS LENTSNFSTSLHALLCSNFPTPEPLSKYSLNPVVKHSLKIWAQFRRSFALKGLSAYAPIARNHMFTPSTI DKTFDIWSMKGLKILKDMFIDGQFASFQQVKVKFQIPNSHFFRYLQLRSFVSSSMSHYPSLPPPSLLDSI MELSPYSKGLIGKIYSIINSHNLEPLVKLKRKWEVELEIELSEDMWQSVLDNIHSSSICLKHRVIQFKVV HRLHWSKVKLAKFKPNIDPNCSIEPATLSHMFWACSKLKKFWHLIFKFLSDALNTYVEPEAIISIFGITP QSLCFNKSKINVIAFATLLARRLILLKWKEKLPPTFKQWLMELLHHLTLEKIRYTFGGCTDMFFLTWQPV LDHVKKMDPSVILEE
Derived:
Positions 114238 120048 Accession No AL645691 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute