Repbase Reports

2002, Volume 2, Issue 4
April 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 12

HARBINGER1_DR

Autonomous Harbinger-like DNA transposon.

Submitted:
30-Apr-2002
Accepted:
30-Apr-2002
Key Words:
DNA transposon; Harbinger superfamily; transposase; DNA-binding protein; TDR; HARBINGER2_DR; HARBINGER1_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
HARBINGER1_DR, an autonomous Harbinger-like DNA transposon from zebrafish.
Journal:
Repbase Reports 2:(4) p. 12 (2002)
Abstract:
HARBINGER1_DR is an autonomous Harbinger-like DNA transposon. Given well preserved 16-bp TIRs, the TAA target site duplication, and encoded protein sequences, HARBINGER1_DR was active in the zebrafish genome recently. The zebrafish genome harbors multiple families of nonautonomous DNA transposons, for example HARBINGERN1_DR, that are derivates of autonomous HARBINGER1_DR-like elements. HARBINGER1_DR encodes two proteins, 424-aa HARBDR1p1 (2 exons, positions 190-419 and 1084-2128) and 250-aa HARBDR1p2 (positions 4001-3249). HARBDR1p1 is a Harbinger/IS5-like DNA transposase. HARB1DRp1: MESIALLSLWVFFLSRLLLSGAQPSHNITMSRSIVFVARKLSRNRAARIRKFARWQLKCS EDFAALLSDYSSCTSIRTTWIRQRSDVWWQHVLTSWTDCEWKDNFRMGRAAFLQLCNRLQ PHIQRQTTTFRKPVPVEQRVAICIWRLATNVEFRTISHLFGIGQSTAVSITNCVASAIVK NLLSIFIRTPSEQEFESIIQGFRDKWGFPQCGGAIDGTHIGILAPPVSSADYYNRKGFYS VILQGVVDHRLMFWDINVGWPGKVHDARVFANSSLFDRGQGNSLFPPNIERFGDVDVPVM LLGDAAYPLMPWLMKPYPENQLTTPAQSTFNNRLSKARMTVERAFGPLKGRWRCLMKRCD CHIDNINSIISACCVLHNYCQLYGEDCDEIATDDENVNSDWNSCHSATRSNATRDALCSY FSNL HARB1DRp2 is a DNA-binding protein with the trihelix motif. It is related to multiple DNA binding proteins and transcription factors identified in plants (GT-1 proteins), insects (GenBank, g7294624) and mammals (GenBank, g12844693). Presumably, HARB1DRp2 is a former host gene captured by Harbinger in the past. HARB1DRp2: MPSVPCPGPFPGSFEKCECAESGPSTVHLAGPGPVGRGVPERGSLGLWRGTLVVRVQACQ SPKLKTLRHLLRHFKTGKNHVTSLSATLLTPKSNRKRTSDAFSATIPKTTVAWKGSLWST DEVQCLLDVWADESIQEQLDKTHKNSEIFRKIKDHLLGRGYQRTTEQCRDKMKKLRAQYL KVRDALRRSGSKPEEKDKFKWYDAVDNIIGSKPSSQPNVLESHSQSMGDSTPSTPSETED TGSERSQRGE
Derived:
Positions 80099 84115 Accession No AL591210 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute