Repbase Reports

2002, Volume 2, Issue 4
April 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 8

CR1-3_DR

CR1-3_DR is a CR1-like non-LTR retrotransposon - a consensus.

Submitted:
30-Apr-2002
Accepted:
30-Apr-2002
Key Words:
non-LTR retrotransposon; CR1 clad; ORF1; ORF2; AP endonuclease; reverse transcriptase; CR1-3_DR
Source:
consensus
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
CR1-3_DR, a family of CR1-like non-LTR retrotransposons in zebrafish.
Journal:
Repbase Reports 2:(4) p. 8 (2002)
Abstract:
CR1-3_DR is a family of CR1-like non-LTR retrotransposons and it was active in zebrafish recently. The consensus sequence encodes two proteins, CR1-3_DR1p (position 254-1801) and CR1-3_DR2p (positions 1805-4717). The 971-aa CR1-3_DR2p protein is composed of AP endonuclease (aa positions 72-282) and reverse transcriptase (aa positions 543-788). The 516-aa CR1-3_DR1p protein is distantly related to proteins encoded by ORF1 in known CR1-like elements from chicken, pufferfish and turtle. CR1-3_DR copies are lesser than ~5% divergent from the consensus sequence. Approximately several hundred copies of CR1-3_DR are present in the zebrafish genome. CR1-3_DRp1: MALDHIDLESHCCTNCHKLLQKIAVLETKLLAIQPELPNYTGPVHRGASQHSAGKPYKSTPATVLRTEKQ IETVENQRELWHKQGARPKGTRGVRSQRSYAAALAFSTPNTARTQIQLQNRYEVLSNMGEESPNAVRQRS HDSAINSAWNRGSRPTRQRHSAPIATEIRTLIVGDSIIKNFRSRSTMTYCFPHATVSDVNKELENILRKH ETAKRIIIHVGKNDIRKEQSELLKRDFCKLLETVERLKIQPFISGPLPARGTNMFSRLLGLNAWLQKTCN KKGLNFIDNFNLFWNQRQLFTSDGLHPNKLGAKVLKDNILFSLHHPSAVYATELNCTHTPSKCPDDHRTS NQLLSGLVADESPKDRDNTTQPQQPPITDKLPSAPCTLSSTQADCDASEQHQVSALIDDPQENSQVNISQ QPETPDPQPLSPDTFSLSSCSPLLDFSKKMEELVCAGTKLSHSIAASPQLATKSQQATRPSLSPPRPTPR KGLRSLRQRQVPKNTSSLAGELKNCH CR1-3_DRp2: CVSGACLDNSVFIRCLQNKQEPSVSVAFSTQICVLLRDRKPKTLSDRIANHSNLVSIKCISETSVVKTTK TVKLALLNIRSLNNKSLLVNDFINTNCLDFMLLNETWLDDSCSAAVLNEAAPLNFDFLSVCRANRRGGGI AALFKDVYECKQVSFGDYLSFEYLSIALKGSPRILLIIIYRPPKYSPAFIEDFTELLSIVTSEYDYFSIA GDFNIHIDNPEINAVKELMTVFNTFDLTQHVQGPTHNRGHTLDLLITKGLHISSTVVKDVALSDHFCIFF DILITPAIKDRSVSVRKRCINENTSEQFMKAISLAPSISADSVDSLLDLFNSKIENVINDIAPVKVRKRT GKERVPWRNSRAVQMKKRQCRKAERMWRKTKLVVHYNIYKDSLQAFNVELKTARQTFFSNLINNNVNNAR TLFATVERLTNPPSRIPSELLSVSKCNEFANFFTDKINNIRKAISSSNQPSCVDIKQTQPQLEKSDIMSD FMAINGKILEEMVQIIKTSTCSLDTLPTSFFKTVFTCSEMDLLKVVNDSLLSGIFPNSLKTAVVKPLLKK SNLDNTLLSNYRPISNLPFIGKIIEKVVFNQVNKFLNFKGCLDNFQSGFRAHHSTESALIKIINDIRLNT DSGKITVLVLLDLSAAFDTVDHSILLDRLENWVGLSGTVLKWFRSYLEGRGYYVSIGDHRSRWTPMTCGV PQGSILAPLLFNLYMLPLSQIMRKNQISYHSYADDTQIYLALLPNDYSPIDTLCQCIDEIKNWMCQNFLQ LNKEKTEVIAFGNRDEVLKVNAYLGSKGQTTKNKVKNLGVTLESDLSFNSHVKAVSKSAYYHLKNIARIR FFVSSEDLEKLVHAFISSRVDYCNGLLTGLPKKTVRHLQLIQNAAARILTRTRKSEHITAVLRSLHWLPV TFRIDFKVLLLVYKSLNGQGPQYITDMLTEYKPNRSLRSLGSYKLEVPRVQSKQGESAFSH
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute