Repbase Reports

2002, Volume 2, Issue 4
April 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 7

CR1-2_DR

CR1-2_DR is a CR1-like non-LTR retrotransposon - a consensus.

Submitted:
30-Apr-2002
Accepted:
30-Apr-2002
Key Words:
non-LTR retrotransposon; CR1 clad; ORF2; AP endonuclease; reverse transcriptase; LINE_DR; CR1DR2; CR1-2_DR
Source:
consensus
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[3] Authors:
Kapitonov,V.V.
Title:
CR1-2_DR, an ORF1-less semiautonomous family of CR1-like non-LTR retrotransposons in zebrafish.
Journal:
Repbase Reports 2:(4) p. 7 (2002)
Abstract:
CR1-2_DR is a family of CR1-like non-LTR retrotransposons and it was active in zebrafish recently. The consensus sequence was reconstructed based on 10 copies that are ~2% divergent from it. Approximately several hundred copies of CR1-2_DR are present in the zebrafish genome. The consensus sequence encodes one protein only, CR1-2_DR1p (position 1111-4005). It is a first CR1-like family without ORF1. A 5'-terminal 1110-bp noncoding is present in CR1-2_DR instead of a CR1-like ORF1. The 965-aa CR1-2_DR1p protein is composed of AP endonuclease and reverse transcriptase domains. Endonuclease/reverse transcriptase proteins encoded by CR1-2_DR-like elements were probably involved in proliferation of SINE_DR1. CR1-2_DR and SINE_DR1 share nearly identical 60-bp 3' tails. CR1-2_DR1p: MCFLIPVVTNTRKTREVRCRRNPHNLRSIHVSTISQLSLSVGLWNCQSAVNKADFITSIATYSDYNLMAL TETWLRPEDTATHATLSANFSFSHTPRQTGRGGGTGLLISKEWKFTLIPSLPTISSFEFHAVTIIHPFYI NVVVIYRPPGKLGHFLDELDVLLSSFSNFATPLLVLGDFNIYVDKPQAADFQTLLASFDLKRAPTSATHK SGNQLDLIYTRHCFTDQTIVTPLQISDHFLLSLNIHITPEPPHTPTLVTFRRNLRSLSPNRLSTIVSDSL PPSRKLTALDSNSATNTLCSTLASCLDRLCPLASRPARASPPAPWLSDALREHRSKLRAAERIWRKTKNP AHLLTYQTLLSSFSAEVTSAKQTYYRLKINNATNPRLLFKTFSSLLYPPPPPASSTLTTDDFATFFCTKT AKISAQFAAPTTNTQDTTPTPHTLTSFSQLSESEVSKLVLSSHATTCPLDPIPSHLLQAISPAVIPTLTH IINTSLDSGLFPTTFKQARVTPLLKKPNLDHTLLENYRPVSLLPFMAKILEKVVFNQVLDFLTQNNLMDN KQSGFKKGHSTETALLSVVEDLRLAKADSKSSVLILLDLSAAFDTVNHQILLSTLESLGVAGTVIQWFRS YLSDRSFRVSWRGEVSNLQHLNTGVPQGSVLGPLLFSIYTSSLGPVIQRHGFSYHCYADDTQLYLSFHPD DPSVPARISACLLDISHWMKDHHLQLNLAKTEMLVVSANPTLHHNFSIQMDGATITASKMVKSLGVTIDD QLNFSDHISRTARSCRFALYNIRKIRPFLSEHAAQLLVQALVLSKLDYCNSLLAGLPANSIKPLQLLQNA AARVVFNEPKRAHVTPLLVRLHWLPVAARIKFKALMFAYKVTSGLAPSYLLSLLQIYVPSRNLRSVNERR LVVPSQRGKKSLSRTLTLNLPSWWNELPNCIRTAESLAIFKKRLKTQLFSLHFTS
Derived:
[3] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Okada,N., Hamada,M., Ogiwara,I. and Ohshima,K.
    SINEs and LINEs share common 3' sequences: a review
    Gene 205 (1-2), 229-243 (1997) MEDLINE 98121295

© 2001-2019 - Genetic Information Research Institute