Repbase Reports

2002, Volume 2, Issue 4
April 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 6

CR1-1_DR

CR1-1_DR is a CR1-like non-LTR retrotransposon - a consensus.

Submitted:
30-Apr-2002
Accepted:
30-Apr-2002
Key Words:
non-LTR retrotransposon; CR1 clad; ORF1; ORF2; AP endonuclease; reverse transcriptase; CR1DR1; CR1-1_DR
Source:
consensus
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[2] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
CR1-1_DR, a family of CR1-like non-LTR retrotransposons in zebrafish.
Journal:
Repbase Reports 2:(4) p. 6 (2002)
Abstract:
CR1-1_DR is a family of CR1-like non-LTR retrotransposons and it was active in zebrafish recently. The consensus sequence encodes two proteins, CR1-1_DR1p (position 311-1216) and CR1-1_DR2p (positions 1220-4300). The 1027-aa CR1-1_DR2p protein is composed of AP endonuclease (aa positions 72-225) and reverse transcriptase (aa positions 559-796). The 302-aa CR1-1_DR1p protein is distantly related to proteins encoded by ORF1 in known CR1-like elements from chicken, pufferfish and turtle. The consensus sequence [2] was reconstructed from 10 copies that are ~1% divergent from it. Approximately 1000 copies of CR1-1_DR are present in the zebrafish genome. CR1-1_DR1p: MSLPSLSLCAGEASMEALELELEEVESQIRALVVRRSRLREQLLVVPNAKAVSSPKVRGNYNHIIPSTST PRPSLSRPSAPGARLSQASFTPTPGYHGAWVQPRKVLPRSRGRTSPPVFEISTENRFSPLRESGPDVAII GDSIVRHVRAASSKGNKVRTFCFPGARVRNISTQIPTILGAAESPGAVVLHVGTNDTGLRQSEILKKDFR SLIETVRRTSPATQIIVSGPLPTYRRGNERFSRLLALNEWLITWCKEQKLLFANNWNLFWERPRLFRPDG LHPSRAGAELLSDNISRLLRTI CR1-1_DR2p: CVSGACLDNSVFIRCLQNKQEPSVSVAFSTQICVLLRDRKPKTLSDRIANHSNLVSIKCISETSVVKTTK LAGKNSQNSHYSHLDSCSPHLNISNAYLANPIETVSVPRIIRLRNKRTVCSRKNLVRIKPEKPVESENTN FVKLGLLNIRSLAPKALIINEIITENNLNALCLTETWLKQNDYISLNEATPPGFLYKHEARQTGRGGGVA SIFSDFLNIKQRNGLMFSSFEVLSLNVQLPDTIQKPMLSLALITIYRPPGPYVKFLKEFSDFISDLLVKT DKMLIVGDFNIHIDDANDTLGLAFMDLIHSLGIKQNVVGPTHRLKHTLDLILSYGIEVIDVDIIPQSDDI TDHYLLLYKLCLPEISKPAPILRPSRTIVPSTKDEFINNLPDLSLFRNAPANSNDLDVVTSSMDAIFTST LNTVAPIKLKKAREIKTIPWYNSHTRALKTATRALERKWKKTNLEVFRIAYKDSMSSYRRALKSARTEHL RKLIENNHNNPRFLFNTISKLANNRSSLEQTTPPQISSDDFMNFFSNKIEGFRQKIGDAKLSAPAYTPNP VNISLNHNNNLHCFKIIEHEELVKIINSSKPATCMLDSIPTKLLKELLPAIGEPLLNIINSSLSIGHVPN SYKLAVIKPIIKKPQLDTNNLANYRPISNLPFMSKILEKVVSTQLCSFLQTNNIFEVFQSGFRAHHSTET ALVKITNDLLLAADRGCVSLLVLLDLSAAFDTIDHNILINRLKSTGVQGQALQWFKSYLTDRYQFVNLNG QPSQICPVKYGVPQGSVLGPLLFTIYMLPLGDIIRRHGISFHCYADDTQLYISTKPDETSELSKLTECIK DIKDWMTNNFLLLNSDKTELLLIGPKSCTQQISQLNLQLEGYKVSFSSTIKDLGVILDSNLTFKNHISHV TKTAFFHLRNIAKLRNMLSISDAEKLVHAFMTSRLDYCNALFAGCPASSINKLQLVQNAAARVLTRSRKY DHITPILSSLHWLPVKFRIEFKILLLTYKALNNLAPVYLTNLLSRYKPTRSLRSQNSGLLVVPRIAKSSK GGRAFSFMAPTLWNSLPDNVRGSDTLSQFKTRLKTYLFSKAYTQCIT
Derived:
[2] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute