Repbase Reports

2002, Volume 2, Issue 4
April 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 4

CATCH1I_DR

Internal sequence of the CATCH1_DR endogenous retrovirus.

Submitted:
30-Apr-2002
Accepted:
30-Apr-2002
Key Words:
Endogenous retrovirus; LTR retrotransposon; BELL/CATCH superfamily; CATCH1_DRp polyprotein; gag; reverse transcriptase; endonuclease; CATCH1_DR; CATCH1LTR_DR; CATCH1I_DR
Source:
Danio rerio
Organism:
Danio rerio
Taxonomy:
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Actinopterygii; Neopterygii; Teleostei; Euteleostei; Ostariophysi; Cypriniformes; Cyprinoidea; Cyprinidae; Rasborinae; Danio
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
CATCH1, an endogenous zebrafish retrovirus from the BEL/CATCH superfamily.
Journal:
Repbase Reports 2:(4) p. 4 (2002)
Abstract:
CATCH1I_DR is an internal portion of the CATCH1_DR endogenous retrovirus, which belongs to the BEL/CATCH superfamily. It is flanked by identical long terminal repeats, deposited in Repbase as CATCH1LTR_DR, and is characterized by 5-bp target site duplication. It is possible that CATCH1_DR is still active in zebrafish. CATCH1I_DR encodes one polyprotein, 2029-aa CATCH1_DRp (positions 190-419). CATCH1_DRp: MESEPPSEADPAVRPRSPRERHLPGHLADYDIQLPPSLHPEVPQTGASSQRPSRRSRHASTSISAGTMSS TSSRSHRSAHYRLPRHGLSDLQAAMLEEKLKTMDLEELQQQIEEEAIVDKECERLDTQAREAQYIQEQAT KARESIAKQVDTRRRLKKVQNELKAAKFVCELLKQESPDVSSNASQSSLAVDLRPEVSPQHDNAVNLNAS VQLMRSHSTPCHVSFVPASSVMHPPVLPVTNSVVTVSEPQLICVTSTPNITQPNIVTNSLAALSTIPPTL MSNSDLVAPLTFESSLVNKPQYCAANSATYSQAPSVRVHNVVPSPATVTVGSPLQVQCYPSMHSSPDGTS APYTGPAPDTSPIRSGLYPSLAQFPGLDMLAASAYGVPKPAIPHFDTGRESDFALLKMALENVMNNQPHL SEHYKYQVLLSHLKLPSALQLAKAYMYDPKPYTAAMQALQDKYGQPRQLVQSELSIILNAPAVKFGDAEA FDSFSLSIQTLVGMLKTLEGPNGYELRCGSHVDRLLSKMPPSNRDGFVEYCFSRGILQTGTDRTYTLPDL SEWLQMKSQAKRISNKAATMYQTENARFIKKEQPRSAPFRIKAKSTSILYSTDGSSAVQGHPKSKPPVKI QPFCPYCNMKDHFLHACPKFKMLTAEKIGEWLSTEKRCWKCGRTHPPDHCTLKKPCTKCKEIHLTILHEA ASQIQNNVLLVNVPSLQVYLDRPNRSQKVMLKIVKVLLHHKEKAMEAYAVLDDGSERSIVLSQVVDQLKL PTEPETLTLRTVHQDVVNLKGANVSFYVSPLHKPFRKYLISHAFTADNLRLSKHSYPVPALQRKYEHLKS LPLPSIDQAQPLLLIGSDMPHLLTPVQPVCTGSSHGPIAICTRLGWTLQGPTGLSQTSVSTPQCLHITTT TQNTELFRNVERLWQIDTLPYTNEKSATRSKHDQYALSLLQSDTTKVEVNGVMRYATPLLRRPNAELLKA SKEAVMANLRSTERKLAKDHKKAEAYCLEMRRLQEAGYVAEISIEEAEQSRESWYIPHHMVTHNGKDRIV FNCSYSYQGQALNDILLPGPILGPSLLGVLLRFRENPVAISGDVKGMFHQVRLLPTDKSVVRFLWRDMQR SNQPKIYEWQVLPFGTTCSPCCAIYALQMIAQTHSDGDPVLESTVKGSFYVDNCLHSLQTVAEARALVDN LRQLLLTCGFELRQWASNKPEVIQHLPPDARSSNSELWLSQKSTDLLEGTLGLLWNCLSDSFSYKPSQIE CFEPTLRNVYKVLASQYDPIGYLIPFTTRAKVLVQDLWKTNLTWDDPITSESLLSRWQTWLQELQGLNHI AVPRCYSPSDWQADKLNRELHIFCDASERVYGSVAYMRTENDQGHVHISFVLARSRVAPRKQMTIPRLEL SAALTGAQVANILQEELTVDINRIILWSDSSTLLQWLKSDSCRYKVFVGTRVAEIQSLTNINSWRYVDSA NNPADVITRGQTLNSLTPPCHWINGPPFLYQPDSCWPTLPADEPEPVTELKKSVICLHVLTCPDTTLPDV NQFSTWAELLKATVTSLHGAATPQTQPQDDSGSYILAEKLLLQQSQRDSFPEEFKALTTNRPLPSNSRLA SLSPEYDEVSGLIRVGGRLRHAHHLELDTTHPVVLDPQHYLTKLLIKDYDTTLLHPGLERVFAEVRRRYW ILRGREAIKKHQYLCTDCQKWRAKPKMPKMADLPPTRLRLYKPPFYSTGMDCFGPFTVKIGRRREKRWGI VFKCLTTRCIHLDLVESLDTDAFLMALRRFISRRGKPFELLSDNGTNFVGGDKELRAAYESMIPQLREQL AEQQITFRFIPPGAPHFGGVWEREVKSVKQALKVVLKDLTVTETVLRTVLIEVEGILNAKPLGYVSSDVS DLDPITPNILLMGRHDSSLPQVFYDSSNVLGTRRWKHSQILADHFWSRFIHYYLPNLQERQKWRKDGGEI GLDQVVLIVDPQLPRACWPVGKVTNTFPGLDGRTRSVEVQVRNRTYVRPVSRLVPLPKHTDDDPVNPDT CATCH1_DRp includes gag-like, reverse transcriptase and endonuclease domains similar to other retroviruses from the Bell/Catch superfamily. N-terminal region of CATCH1_DRp (positions 20-250) is similar to coiled coil domains present in various myosins. Gag-like domain (including zinc fingers) is located at ~420-770.
Derived:
Positions 62281 55361 Accession No AL591492 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute