Repbase Reports

2002, Volume 2, Issue 4
April 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 2

ATHAT10

ATHAT10 is a hAT-like autonomous DNA transposon - a consensus.

Submitted:
30-Apr-2002
Accepted:
30-Apr-2002
Key Words:
Autonomous DNA transposon; hAT superfamily; ATHATN10; ATHAT10
Source:
consensus
Organism:
Arabidopsis thaliana
Taxonomy:
Eukaryota; Plantae; Embryobionta; Magnoliophyta; Magnoliopsida; Dilleniidae; Capparales; Brassicaceae
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
ATHAT10, a hat-like autonomous DNA transposon from Arabidopsis thaliana
Journal:
Repbase Reports 2:(4) p. 2 (2002)
Abstract:
ATHAT10 is an ancient autonomous hAT-like DNA transposon. There are several copies of ATHAT10 present in the genome. They are ~95% identical with the consensus sequence. ATHAT10 has 12-bp terminal inverted repeats and encodes the ~670-aa ATHAT10p transposase (there is one false frame shift at position ~1350). The ATHATN10 DNA transposon is a nonautonomous derivative of ATHAT10. CDS join(884..2869) ATHAT10p: MSSDSFRSNIGTPIEDVHNSTPAINTQESATEEQANTSSGKQRLNASDIFKVHFRKEKIDGKMKACCNYC NKSFFWKSGSGYGSYRYHLVNNHPEKYGGETQNATSANLSNFHYSDKRNREELAKCVAVDHLSFSFGEKL GFNNYCQKALNPQAKRVPRTTLTRTLKSLYRKTKKRFRMFVFLPNNVSICSDIWSDQWQIHHYMGITSHW LDSDWIIQKRIIAFRVFYERHTSDNIFKLIKIILEEYNLTNKIFSISFDNASANTASIDELINNCSPILG GKYFHVRCICHVLNLCVQDGLLVSQNNLISPIKTALNYLWGHPQLMKKWFRFCKMHNVSPKRFSRDVPTR WNSTYDMLVDSIGYKDLLCSFIQQNCSSLTLWPTHWDDCNALLKLLKCFNDATFLLSGVYYHTSHLLLYE CVNIADVMHEHENNTVLSSCITSMRDKWLKYYREIPPLNLLASVFDPRTKFDGLYDYLVAYYDLLHLSDS INVPSIISNSRKDIENLYDEYYRLYEHLVPQGTESSLQNDMSSTSTLSLAERMRRRKRQRPSQGNNAELE KYLSTNFEFSDADAGNNFQIIHWWKSHQSQYPILAMIAKDVLSSPVSTVSVERAFSMGGQILDETRSRMS PDSLEAQACLDDWTRAGYRQQEFLRENEEELEDIDSDVSSTRSEDSD
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute