Repbase Reports

2002, Volume 2, Issue 3
March 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 8

ROOA_I

ROOA_I is an internal portion of the ROOA endogenous retrovirus - a consensus sequence.

Submitted:
31-Mar-2002
Accepted:
31-Mar-2002
Key Words:
Endogenous retrovirus; LTR retrotransposon; BCDPR superfamily; gag; Reverse transcriptase; endonuclease; env; ROOA_LTR; ROOA_I
Source:
consensus
Organism:
Drosophila melanogaster
Taxonomy:
Eukaryotae; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
ROOA, an ancient family of endogenous retrovirus ancestral to the modern ROO family.
Journal:
Repbase Reports 2:(3) p. 8 (2002)
Abstract:
ROOA is a family of ancient endogenous retroviruses that were active in the D. melanogaster genome ~2.5 Myr ago. ROOA belongs to the BCDPR superfamily of retroviruses. ROOA_I is ~62% identical to ROO_I, an internal portion of ROO currently active in D. melanogaster. The consensus sequence was reconstructed based on 5 copies of ROOA identified in chromosomes 2 and 4. The gag and env regions are not complete because of a lack of sequence data. ROOA_I copies are 96% identical to the ROOA_I consensus sequence. The reverse transcriptase and endonuclease domains are encoded by the ~4000-bp ORF. It encodes 1351-aa polyprotein (ROOApol, positions 1298-5350). ROOpol: RNFSRKFSPDAIQLYEQHVKKARASLQDVLEFIEQQYNSVNAITKNTAQLATRKVQVRSCAFCSKDGHDM IKCLKFKAQSIEKRKEFVQKNSMCLRCFGKHNAIDCRKEITCNRCSKGHNSLLHEDTKRSINSNSLKQGQ DTLLATAVVLVKNKAGGYNELRALIDGGSQKTLISEEAAQILRIPRVRNTIEVEGISQTTQLSKNCDHLT IKKNIPSSFKTSTEALVLPTLHRALPSKMFDIDINKEWKGYRLADPRFNEPSRIDMVIGVDLFPLIMMEK IKTVNGILGQKTRFGWIVSGNITRAAKQKIISATTTINLKDLERFWELEDEADETITDNAECERKFQETT VTNEEGRFVVSIPFHQLHHKEAKLGDSRKQAMARLMQMEKKNRAAYNEFFKETLKMGHLESVKTTGQGKY YLPHQAIIRPGSLTTKLRVVFDASAKTTNGLSLNDVIIAGPKIQKDIFDILINWRKWQYVMVADIEKSYR QIKVAEKDQEYQYILWRDDPKLPISEFKLTTVTYGTSAAPFLAVRCLRELADRFCQEDSVLAETIRDDFY MDDIITGGDTVNECYELQRKSRQVMEKVGMHLRKWVANDERILADIQDDGAMEKICIEENESIKTLGLQW DPKKDTFTFLAENPMLTRITKRLVLSQLSRIFDPLGWLAPVTIQGKCFIQELWKLPMTWDVELESNLANW WMEYAKGLSYLEEISISRWTGCSKGIMELHGFCDASEKAYAAAVYTKVGGRVTLLAAKSKVNPIKNRKTI PKLELCAAHLLAKLLAKVQAIWSNKITTHAWSDSQITIAWIPNKRSKDKFVRTREEEINKLIPNVKWNYV KSKDNPADVASRGISPQALKICEIWWRGPNWLAIDAQHWPTQKESEIVVVSTLIKSEYLQNHLLSKYSSI DKLLRVMAYVLRFITKLRGKSQQPSHLTAEELKLAKIAVVKIQQQLDFGHEVRLLKNKRPLDPKSKLQAL NPFLDSDGVLRVGGRLQNAMIPYNVKHPIILDKSHLTWLIAKDAHKETLHGGINIMRTYIQREFWIFGIQ NSLKKYLRECIVCIRYKQEMSSQLMGNLPVYRVTTDYSFQNTGIDYARPFQIRCSKARGQKTYKGYICVF VCMATKAIHLEAVSDLSSDKFLEALRRFFARRGKSENLYSDNGTNFVGASRVLDKEFVAAIKNNNELAPT LEKEGIKWHFIPTGSPHMGCLSESGVKSVKHHLKRVICENSFTYEEFASLLCQIEAVLNSRPLVTVRSEN DGQYILPPGHFLVGRPLIGAPEHFGESKTISSLDRWKLIQRIRGDFWKKWKEEYLVSLQQRTKWRQEKPN LKEGQLVLIKHENTHPARWPA
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute