Repbase Reports

2002, Volume 2, Issue 3
March 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 6


LOOPER1_DM DNA transposon - a consensus sequence.

Key Words:
DNA transposon; Looper/PiggyBac superfamily; transposase; TTAA; LOOPER1_Dm; LOOPER1_DM
Drosophila melanogaster
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Looper1_DM, a family of Looper/PiggyBac DNA transposons in D. melanogaster.
Repbase Reports 2:(3) p. 6 (2002)
LOOPER1_DM belongs to the Looper/PiggyBac superfamily of "cut and paste" DNA transposons. This family was active in a recent past (several million years ago). It has 16-bp TIRs (one mismatch) and its copies are flanked by the 4-bp TTAA target site duplications. The consensus sequence was reconstructed based on alignment of 5 copies. LOOPER1_DM encodes the Looper1DMp transposase (positions 505-1542). Looper1DMp is closer to Looper/PiggyBac transposases identified in the human genome than to the PiggyBac transposase found in moth. Looper1DMp: MEDISTVLEKNLEGILERGESIEIDLLENTVIEGCEPDSCVVVDSCLEKIDPKTLKWRTRPFVAPESIWE DDKTFDVGEIKTPVEFFYTLFDTQLIHLMARQTDIYSLQEHGIELKCTDEEIKRYIGILLYFGVLKLPQF RMAWSKDLKITAITDSMPRGRFKKIKQCLHFNDNAKQLKKGDCNYDKLYKIRPLLRILKENFGKTNAGRA SKCRXANNCIQRYVFNFLLNLLYFYXLLLLQVDPRLYNPNLINGVLKLFTRAGISGLVYDFTLYVGEGTS PSYGLGISSYVVLYLAESLPKDKNFKLYFDNWFTSVILLISLKEIGIFATGTVRMIKLNIGXFLEKEDVA DCAKLQHR
[1] (Consensus)
Download Sequence - Format:

© 2001-2020 - Genetic Information Research Institute