Repbase Reports |
|---|
| 2002, Volume 2, Issue 3 |
| March 31, 2002 |
| Copyright © 2001-2016 - Genetic Information Research Institute |
| ISSN# 1534-830X |
| Page 3 |
G6_DM |
|||
|---|---|---|---|
G6_DM is a non-LTR retrotransposon - a consensus sequence. |
|||
|
Submitted: 31-Mar-2002 |
Accepted: 31-Mar-2002 |
||
|
Key Words: Non-LTR retrotransposon; ORF1; ORF2; DNA/RNA binding protein; endonuclease; RNase H; JOCKEY clad; G6_DM |
|||
|
Source: consensus |
Organism: Drosophila melanogaster |
Taxonomy: Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila |
|
| [1] |
Authors: Kapitonov,V.V. and Jurka,J. |
||
|
Title: G6_DM, an ancient family of non-LTR retrotransposons from the Jockey clad. |
|||
|
Journal: Repbase Reports 2:(3) p. 3 (2002) |
|||
Abstract: G6_DM belongs to the JOCKEY clad of non-LTR retrotransposons. G6_DM forms a separate family of retrotransposons that were recently (~0.6 Myr ago) active in the D. melanogaster genome. There are 7 copies of G6_DM in the sequenced genome, they are ~1% divergent from the consensus sequence. G_DM is the element most similar to G6_DM (72% identity). It's very likely that G6_DM elements have been multiplied as nonautonomous elements. ORF2, which encodes pol (G_DM, positions 1671-4035), is almost completely deleted in the consensus sequence (positions 1743-1744). G6_DM encodes G6p1, a 430-aa gag-like protein (positions 322-1611). G6p1: MDWQAPPRTHKLGTTPRKKALRTRKSSSSSEGSTSHTEPDEIKRKPAKKAQGEELEEKPSTSAALRKKLA NNAFALLSSEEDEDDQESSDDEPGPKDDSKPKTPEKPKPTPKTIKPPPIFIPDVTNISALVKMITTLVGP KNNFTYKTVNGNNVRVMMPDKESYTALRLQLVAQNKRHRTFQPKDERAYKVVIKGLHHSTDREEIIEDLR RQGHAVRDLHNPIGRRTKEPLGIFFANLEPSSNNKDVYQVKRICRSVVTIEPPQKFNDVPQCFRCQGFGH TQRYCFLEYRCVKCGGPHESRACEKREDDKACCFHCQADHPASFKGCPAYKRAKALAAPKTRPVANANKA PPVASPNVTSGRSYRDALNGVHAAPQNPTTPVQTQTETPHSGQIEAMFARMEGMMERMMERMFTQMTQLV ATILNSKSCN
|
|||
|
Derived: [1] (Consensus) |
|||
|
Download Sequence - Format: IG, EMBL, FASTA |
|||
|
References: |
|||