Repbase Reports

2002, Volume 2, Issue 3
March 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 3


G6_DM is a non-LTR retrotransposon - a consensus sequence.

Key Words:
Non-LTR retrotransposon; ORF1; ORF2; DNA/RNA binding protein; endonuclease; RNase H; JOCKEY clad; G6_DM
Drosophila melanogaster
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
G6_DM, an ancient family of non-LTR retrotransposons from the Jockey clad.
Repbase Reports 2:(3) p. 3 (2002)
G6_DM belongs to the JOCKEY clad of non-LTR retrotransposons. G6_DM forms a separate family of retrotransposons that were recently (~0.6 Myr ago) active in the D. melanogaster genome. There are 7 copies of G6_DM in the sequenced genome, they are ~1% divergent from the consensus sequence. G_DM is the element most similar to G6_DM (72% identity). It's very likely that G6_DM elements have been multiplied as nonautonomous elements. ORF2, which encodes pol (G_DM, positions 1671-4035), is almost completely deleted in the consensus sequence (positions 1743-1744). G6_DM encodes G6p1, a 430-aa gag-like protein (positions 322-1611). G6p1: MDWQAPPRTHKLGTTPRKKALRTRKSSSSSEGSTSHTEPDEIKRKPAKKAQGEELEEKPSTSAALRKKLA NNAFALLSSEEDEDDQESSDDEPGPKDDSKPKTPEKPKPTPKTIKPPPIFIPDVTNISALVKMITTLVGP KNNFTYKTVNGNNVRVMMPDKESYTALRLQLVAQNKRHRTFQPKDERAYKVVIKGLHHSTDREEIIEDLR RQGHAVRDLHNPIGRRTKEPLGIFFANLEPSSNNKDVYQVKRICRSVVTIEPPQKFNDVPQCFRCQGFGH TQRYCFLEYRCVKCGGPHESRACEKREDDKACCFHCQADHPASFKGCPAYKRAKALAAPKTRPVANANKA PPVASPNVTSGRSYRDALNGVHAAPQNPTTPVQTQTETPHSGQIEAMFARMEGMMERMMERMFTQMTQLV ATILNSKSCN
[1] (Consensus)
Download Sequence - Format:

© 2001-2020 - Genetic Information Research Institute