Repbase Reports

2002, Volume 2, Issue 3
March 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 2

G5_DM

G5_DM is a non-LTR retrotransposon - a consensus sequence.

Submitted:
31-Mar-2002
Accepted:
31-Mar-2002
Key Words:
Non-LTR retrotransposon; ORF1; ORF2; DNA binding protein; AP endonuclease; reverse transcriptase; RNase H; JOCKEY clad; G5_DM
Source:
consensus
Organism:
Drosophila melanogaster
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
G5_DM, an ancient family of non-LTR retrotransposons from the Jockey clad.
Journal:
Repbase Reports 2:(3) p. 2 (2002)
Abstract:
G5_DM belongs to the JOCKEY clad of non-LTR retrotransposons. Its copies have poly(A) 3' tail and they are flanked by ~10-bp direct repeats generated upon integration into genome. G5_DM forms a separate family of retrotransposons that were recently (several million years ago) active in the Drosophila melanogaster genome. There are about 15 copies of G5_DM in the genome, they are ~4% divergent from the consensus sequence and ~10% divergent from each other. Although the G5 copies have accumulated multiple mutations, the consensus sequence contains two ORFs (positions 411-1976 and 1966-4683) that encode the 522-aa G5p1 and 906-aa G5p2 proteins, correspondingly. G5p1 is a putative DNA/RNA binding protein: MDNGPQQKSIDYESMMLIAGAGPKEIREQMKKSWKSETPASATTGISNTYCSSTFTLTSTSSTISSAYIF TSSLSGNICSTAASTIHKSASVSSIAKPQLATGWHDVSFKSRNGGIKKRAGAVFSPKMAKKVATDMPAKI SANCFQVLSDDEDMVVGEASSSDDDEPCSSNTALKRAARKAGPKQQLKGAHQTVPAAPKSSRHSKVPRMM FPNVVNFTAFRSELDALVGDSYTIKVLNSGDCAVQCNSPDSYRLVARHFLDKGSLFHHHQLPEDRPYKIV MRNIHHGVPSEDIIATLQNEGHNVVRIYTPRNKATSLPLNMRFIDLKKAENNNQIKGISVVCRHRVIWEK PRKQSEPIQCHRCQGYGHTKAYCSRHYICRECGENHPTAECKLEQDEARFCFHCGGPHAANFKGCKKYLL EASNRKNQRKVNEPSGSGPARGPHQPCPPAHMSGKPSFANFVRGSQPVAKPAVIVPHASANLESKLEQLF IRLDRMMSLVETLMQLLLQTRTFPSAAQNGSS G5p2 is composed of the endonuclease, reverse transcriptase and RNase H domains: MGPLKVAAWNANGASSKTNEILAFIELHEIDILLLSETHFVSRSTFRVPGFTLHTANHPDDSKRGGAAIL IRSLISHLPFSTLSENHIQTAVIQLTASRGTFNIASVYCPPNLRWTEADVELIIAQFGTKFLAAGDWNAK HRWWGNYRMCTRGRVLFSALAGEGIDIVATGEATCYPFRASATPSAIDFGISKGFRQQEINVQLLTELSS DHLPLLFELDEDAQLFKGVTKMLSPTANTVAFKEHIEATVDLNIPIDTCNSLEAYVDYLAATIAEAARRA TPPPHQARHTTARRAPILSLEARELLSHKRRLRRRYIATGDPSIKQLYSSTTNKLHRLLARTRRENLDTL LEGTGPDNNSHFSLWRLTRGIKRQPLFQSPVQSHSGLWLKTDDEKARAFASHLTSTFMPFNLTDDSNRVA IINFLDTPTAPARPIRHTTPQEVIMQLKALQIKKTPGYDGIDNRAAKSLPRKGVLALVKIFNAMLRLGHF PRQWKRARIIMIPKAGKPPTKIDAYRPISLLSTFFKIFERILLARLMELPQVVNHIPRHQFGFRKSHGCP EQIHRLVNQVTHGFEHKLYTVGVFLDVKQAFDRVWHEGLLYKMKALLPAPYYAILRSFISHRTFDVAVRD ARSSLEEIHAGVPQGSVLGPFLYTLYTADLPSPANNTEVSPDQLLLATYADDTAMLASHPVLQTASNAVQ EWLHAVEKWTAKWNVAINSSKSACVTFTLRPGTCTDLTFDGNPINNVTSHCYLGVHLDRRLTWRAHITSV KFKSLAKLKKLDWLFHSSKLQMSSKALLIKAILAPTWSYAIQVWGTAAKSQLNRLRVVQSRAARHASGLP WYVTNQVIERDLKVTPLGDQINFHSSRYADRLMVHPNRLANILANPISLRRLKRVHPTDLPTRRIV
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute