Repbase Reports

2002, Volume 2, Issue 11
November 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 25

TRANSIB1_AG

TRANSIB1_AG is a TRANSIB-like DNA transposon - a consensus sequence.

Submitted:
00- - 0
Accepted:
30-Nov-2002
Key Words:
DNA transposon; TRANSIB superfamily; transposase; TRANSIB1_AG
Source:
Anopheles gambiae str. PEST
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
TRANSIB1_AG: a family of TRANSIB-like DNA transposons from African malaria mosquito.
Journal:
Repbase Reports 2:(11) p.25 (2002)
Abstract:
TRANSIB1_AG is a family of DNA transposons that belongs to the TRANSIB superfamily originally identified in Drosophila (see description of TRANSIB1-TRANSIB4 in drorep.ref). Members of this superfamily encode the TRANSIB-like DNA transposase and generate 5-bp target site duplications. The TRANSIB1_AG consensus sequence was reconstructed based on multiple alignment of several copies of this transposon identified in the sequenced portion of the genome. Given the ~2% divergence of these copies from the consensus sequence, transposition of TRANSIB1_AG occurred recently (in the last 1 Myr). TRANSIB1_AG has 9-bp terminal inverted repeats. The consensus sequence encodes a 708-aa TRANSIB1_AGp transposase (positions 1539-3665). TRANSIB1_AGp is 29% identical to the TRANSIB2p transposase encoded by TRANSIB2 from D. melanogaster. TRANSIB1_AGp: MIEILLFNDFFNCVQHAHLIFFPLIQNVTQITNRELVLQFNFQNSAKLNVENAFRFVCETLESSDIDEDA VKQKLNLLERRAKHLWKKTNSDRNKFDRANFAWLNTQFLCDFKREKITIIQSKKLFIELTNRQKRRRIAQ MSSSVKCESVDEALMFARKIATQQKNTYVVNALTNMINCSTPAMKSGEEALSFLIEGNFSKKQYCIIRKE CPSKFRSYMEILKAKKTCSPSAESLHVTESSVKVDLQSLVHMTTKSIVRMEKDKIFAYMDSRKLNHLKLI LLMAWGMDGSSGHSQYHQNYSNETADDSNVLITSLSPINLTVEGDSSNEIMWSNLTPQSVRFCRPISMIF AKENRDLVINKKSEIEAEIEALRPYLFETENREKSVIVEFRFVLSMIDGKILSYITQIPTSCCPICGSKP TEMQNVKYIDNGFQPSPGSLIHGISPLHCWIRVLECILHISYRLDFTKWKVTAHYREAYNNRKRIVLRDL FTKFGVKVDQVRAGSSGTSTTGNVCRRIFSNPKLASEALGVDEDLIRRFRNILIAINSERPFNAETISLY CKDTYYKFINLYSWYYIPATVHKILAHAGELILNTPVPLGSIGEECGEARHKIFRKDREYHARKCTRESN LVDVFMRAIHSSDPFISSLSLQNRVQRKMSDNYPEEVKLFFEFEQLNSNENVPPLEESFEDIMDTLDKMN EPLVQDMG The A. gambiae genome harbors several families of TRANSIB-like DNA transposons.
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute