Repbase Reports

2002, Volume 2, Issue 11
November 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 23

RTE-1_AG

RTE-1_AG is a RTE-like non-LTR retrotransposon - a consensus sequence.

Submitted:
00- - 0
Accepted:
30-Nov-2002
Key Words:
non-LTR retrotransposon; RTE clade; endonuclease; reverse transcriptase; AGRP1; RTE-1_AG
Source:
Anopheles gambiae str. PEST
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[3] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
RTE-1_AG, a family of RTE-like non-LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 2:(11) p.23 (2002)
Abstract:
RTE-1_AG is a family of RTE-like non-LTR retrotransposons. The RTE-1_AG consensus sequence was reconstructed based on multiple alignment of ~100 copies identified in the sequenced portion of the genome. Given the ~2% divergence of these copies from the consensus sequence, transposition of RTE-1_AG occurred less than 1 million years ago. The RTE-1_AG family is composed of several subfamilies. The consensus sequence encodes a 972-aa RTE-1_AGp protein (positions 373 3288), which is composed of the AP endonuclease and reverse transcriptase domains. The 3' terminus is composed of the TAAG microsatellite. RTE-1_AGp: MGSWNVRTLSEAGALKKLDDALATLSMDLVALQEIRWLGNGVHNRRGKHCYDIYYSCHDRHRVLGTGFAV GPRLKPAIMDFKAINDRLCTLRMRGKFFNISLINVHAPTEDKEEEEKDLFYGRLARIVDACPRHDLIIIL GDFNAKVGREPMYRQYTGCHSLHEHSNDNGSRLVQFAAANNLVVGSTKFARKKIHKITWAHPGGESFNQI DHVLISRRRQSSLLNVRTYRGANIDSDHYLVGLVIRCRIARPRANGGGENTQARLNTDSLRDIAVQQEFK TALEESLLPEDRYETTSERWNALKTKIINCARNILPPRRGNTKSGWFDDECRQVTERKNTAYRAMQQRHR TRACAEEYSRLRREEKRVHRSKKHALEEQNMRELEQTREAYGPTRKFYQAIAGHRNNVVPKVTCCRNKDG DLVSNQPEVLSRWAQYFDELLNDQFSEQLEAPLADNVMLLPPSIEETRKAIRRLKNNKAPGTDGIAAELV KNGGARLENEIHQIVTEVWDSESMPCDWNLGIIYPIYKKGDRLDCNNYRGITVLNTAYKIFSLILQDRLV PHVEEIVGNYQRGFRNGKSTTDQIFTMRQILEKMAEYKNDTYHLFIDFKAAYDSIARVKLYDAMSSFGIP AKLIRLVRMTMTNVTCQVRVDGKLSGPFATTKGLRQGDGLACLLFNLALERAIRDSRVETTGTIFYKSTQ ILAYADDIDIIGLRLSYVAEAYQGIEQAAENLGLQINEAKTKLMVATSADLPINNPNLRRRDVQIGERTF EVVPEFTYLGSKVSNDNSMEVELRARMLAANRSFYSLKKQFTSKNLSRRTKLGLYSTYIVPVLTYASETW TLSKSDEALLAAFERKMLRRILGPVCVEGQWRSRYNDELYEMYGDLTVVQRIKLARLRWAGHVVRMETDD PARKVFLGRPQGQRRRGRPKLRWQDGVEASAIKAGITDWQTKARDRERFRTLLRQAKTAKRL.
Derived:
[3] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:
  1. Reiss,R.A.
    A study of repetitive DNA elements in the malaria vector, Anopheles gambiae.
    Thesis (1991)
  2. Reiss,R.A., MacIntyre,R.J. and Hagedorn,H.H.
    A repetitive element of the Malaria vector, Anopheles gambiae.
    Unpublished (1993)

© 2001-2020 - Genetic Information Research Institute