Repbase Reports

2002, Volume 2, Issue 11
November 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 22

P3_AG

P3_AG, a P-like DNA transposon - a consensus sequence.

Submitted:
00- - 0
Accepted:
30-Nov-2002
Key Words:
DNA transposon; P superfamily; P3_AG
Source:
Anopheles gambiae str. PEST
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
P3_AG, a young family of P-like DNA transposons from African malaria mosquito.
Journal:
Repbase Reports 2:(11) p.22 (2002)
Abstract:
The A. gambiae genome harbors many divergent families of P-like DNA transposons. One of the youngest families is P3_AG. Some P3_AG copies are identical to each other. It's possible, that P3_AG is an active DNA transposon. P3_AG elements are flanked by 8-bp target site duplications. Terminal inverted repeats are 29 bp long. The P3_AG encodes a 879-aa P-like DNA transposase, called P3_AGp. Predicted exon/intron structure (based on FGENESH and GENSCAN): 356-614, 679-2198, 2260-3120). The P3_AGp transposase is 43% identical to the P1_AGp transposase encoded by P1_AG. P3_AGp: MPRSCAAAFCKNNAENVKKRGLNITFHSFPSDDSLPKWIDFCKRDEHWKPTKISTVCSLH FKPDDYQMAKSSLPQTLPVLKRLKPYAIPSLIQPADFIQNEPSNMTAPLKECNQPNVEFQ TDSEYFSDVENVPSQTIIDMKRELDQVKEDNRKLIEVNTNLRDKLHSYFNENKRLKAEID NLQKHISKKDAGIDEAALVTAMKERLKPTLSENQIDIILKKKKRVVWTKEEIGSALTLKY FGLRCYKYLAKDRKFPLPADATLKRYTKNLVVKEGILDDVLKLISNLTSTFTEKDRLCAL SFDEMKVNRIIELDKASDEIIGPHNYLQVVMARGLCNKWKQPVYIGFDKKMTKEILLKII EKLSEININVVAIISDNCSTNVSCWKELGAKDYERPYFQHPTTLNNVYVIPDAPHLLKLL RNWFLDSGFTYNGKHIKADLLFDMIASRNETEITPLYKLSKTHLVMTPQERQNVRRAAQL LSHTTAISLRRYFKNNAEATDLANFIEKVDLWFSISNSYSPFAKLDYKKSYTASDDQIKA LDEMFEIVSNMTVIGKHSLQIFQKSLLMQITSLKLLYDDLHKRHNISFISTHKLNQDVLE NFFSQLRQIGGVYDHPSPMSCIHRIKMIILGKAPTFLKNQTDLEPSTFSCTDEYISSQIR TSIEIENEGSEQANDGDIISASIITSALNQPPVKQSIQSDTLSSRSSEMLSSVSSSAIEL PEQDSDGLEYIMGYIGRQCFEKFPHLNLGNLSLNLNSDHSYSHPPSFVKHLSVAGLFVPS EAFLKQGYKMEKIFQKLHPNGNFNKKRYISKRLVKRLQKEFPELPLIVVQQFAKHRINIR IKFLNMKIANEKRVNNKRKAPSHSKTAKKCEKLQISCFV.
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute