Repbase Reports

2002, Volume 2, Issue 11
November 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 20

P1_AG

P1_AG, a P-like DNA transposon - a consensus sequence.

Submitted:
00- - 0
Accepted:
30-Nov-2002
Key Words:
DNA transposon; P superfamily; P1_AG
Source:
Anopheles gambiae str. PEST
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
P1_AG: a family of P-like DNA transposons from African malaria mosquito.
Journal:
Repbase Reports 2:(11) p.20 (2002)
Abstract:
The A. gambiae genome harbors many divergent families of P-like DNA transposons. One of those families is P1_AG. P1_AG elements are flanked by 8-bp target site duplications. Terminal inverted repeats are 11bp long. The P1_AG consensus sequence was reconstructed from several copies that are only ~1% divergent from each other. Presumably, P1_AG copies have multiplied in the genome during last 1 million years. The P1_AG encodes a 895-aa P-like DNA transposase called P1_AGp. Putative exon/intron structure (based on FGENESH): 302-563, 624-734, 797-2262, 2433-3281. P1_AGp: MSSNYKCCVAFCKNNRYNVKKVGVNVCFHKFPEGKETKQKWIAFCQREISWIPSSSNVVC SQHFLPSDYQLSSSHNTKRGANWLNPEAVPSILLPQDTGLNLSQFNEHQQNNNNDESSRA ELQGATSSHLLPDENDLILIGKENVCKKCKGLQQKIFNLEAKLNELEERNKQLVTINNKL SDTLKEVNEKEKEHLKKLEELDKATKKIKEEWPRANFVQNMKDSLKGSLSSNQIDLILGI KKTVRWTKEELSLAFTLRYFSQRAYRYIGDDMKIPVPVPRTLQRYSSKIDLKQGILEDIL KFIGSYSQTLKPMDRECVLSFDEMKVSRVLEYDPSADEIVGPFNYLQVVMMRGLFKQWKQ PIFIGFDTKMTKDIIIEIISRLSEKDINVVAIISDNCQTNIGCWKELGARDDVEKPYFPH PKTNKNVYVIPDTPHLLKLLRNWLLDHGFEYNGQLIETTNLLRMVAKRMESEMTPLFKLT TSHIDMTPQERQNVRRAAELLSRTTAVALRTYFPDDDNAKILANFIEKVDVWFSISNSYT PFAKLDFKKAYTASDDQVRALTDMYDIISNMTIPGKNGLQIFQRSIMMQIKSLQMVFADM KLKHDAKFICTHKLNQDVLENFFSQLRQIGGVYDHPSPLSCIYRIRLMILGKTPTILHNQ TTTVEAANCEQDEFITTTESNVAGARSNDVFISASMFEKAEITPELPDVKAMEEANNFVS QDVSSLSSVSDTSIELPHQEADGLSYILGYLAKKHHSQFSHLNLGEHTFKTRIDHNYCQP PTFVHHLSCGGLIEPSDEFLNLGKKMEKIFLKMNPDGGLLKGERIVDRITNKIKRHLTEL PVEIIRSFAKQRVIVRMRYLNLKATAEQLNKMKHKKRKFVTENTKAAKKMKKIIN.
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute