Repbase Reports

2002, Volume 2, Issue 11
November 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 14

INVADER1-I_AG

INVADER1-I_AG, an internal portion of the INVADER1_AG Gypsy-like LTR retrotransposon - a consensus sequence.

Submitted:
00- - 0
Accepted:
30-Nov-2002
Key Words:
LTR retrotransposon; endogenous retrovirus; Gypsy superfamily; INVADER group; gag; protease; reverse transcriptase; integrase; INVADER1_AG; INVADER1-LTR_AG; INVADER1-I_AG
Source:
Anopheles gambiae str. PEST
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
INVADER1_AG: a family of Gypsy-like LTR retrotransposons from African malaria mosquito.
Journal:
Repbase Reports 2:(11) p.14 (2002)
Abstract:
INVADER1_AG is a member of Gypsy-like retroviruses that belong to the INVADER group originally identified in Drosophila (see description of INVADER1_DM in drorep.ref). Members of this group encode one long polyprotein composed of the gag, protease, reverse transcriptase and integrase domains. A similar 1363-aa polyprotein, called INVADER1_AGp is encoded by INVADER1-I_AG (positions 488-4576). INVADER1-I_AGp: MATVKQLCEDFTKIGLVRECERLGLETTGGKVEIANRIVKYRATVASGDNAGPSGSGHRAEPANATDDVE NYAGNQPYESCDDDSEEKADLDLPEEEHGDSFVAEDDDETEEDPFQTAVRISTPKRPQRVYAFRDVEDSI ETFGAEDGHDVRIWLAHLDSVSKSAGWNDEQKLIMLRKKMTGIARKFVSSLRNVQTYAILKKELIAEFAP FVRSSDVHRILANRKKETAETMREYVYEMQRIAAQIDLDEPSLCEYIVNGVTDDDFFKSLLYEAQTIRVL KEKLLNFEKVRMARKKKTTDKEENKRVLSSSSRVDKRAEQRCYNCGNKGHQARACAQTQGGPKCFSCREY GHKASECARNKSVVPAKINVTEESVGMVDVVLNKTSVKALFDSGSNQNLVTIGCYKRIEGSPLIDTSMWF QGFGGMRTKAIGMFTVDVTVDDNVFSGVRFFVVPNESMSYDAVLGRDSLNYFEVTMTTAGVKVRPYGSTD EMFSIVCDNEDNLDVSPRFSERVKAVISGYKPAGNVNSRVETKIILHDETPVRSSPRRFAPGEKAVLEKT IDEWLAAGIIRESESDFASPVTLARKKDGSLRVCVDYRELNRKMVKDCFPMRNIEDQIDRLKSARVFTTL DLKNSFFHVPVEKSSQRYTGFVTHTGQYEFLRTPFGLVNSPASFSRFVADVFREFIKSERVLVYVDDLII PSLDEESNFQTLKELLNVASENGVQFNWKKSQFLKDEVEYLGYVIRGGCYRIAPSKLRSVQLFPEPKNVK QLQRFLGLTSYFRKFIAGYATISKPLTSLLQKGVEFVFGEEERSSFDELKRCLVTDPVLKIYDESAETEL HTDASKYGYGAALMQKSDDDKFHPVAFMSQQTSNAEKNYSAYHLEVLAVVRAVEKFRVYLLGIKFKIVTD CAAFGHTLKSKELSARIARWALMLEEYEYEVVHRPGSSMKHVDALSRAPVMIVKSDPMIEAIRKMQQSDE RAKAIIELLKTQSFEDFVMCDGLLMKVVKGREVIVVPSGMQSDLIRRIHEKGHLGARKIEGIIEQEFYIP NASEKIKQTIECCVKCILAERKRGKVDGLLYPIAKGDVPLDTYHVDHLGPMDITEKRYKYLFVVVDAFSK FTWIYPTKTTNSFEVIQRLTTQSEVFGNPRRIISDKGAAFTSNDFKRYCEDQDIERVEVTTGVPRGNGQV ERVNQVIIAMLRKMSVNDPAKWYKHVANIQRWINSSPHQSIGVTPFEAMFGVPMRHEGDLRLGELMEEIR VAQHHDQREQTRAGARVSIEKAQEEQRRSYDLRARSATTYREGDLVVIKRTQFGPGRKYAAEYLGPYKVT SVRPHDRYDVEKINGEGPKVTSTASSHMKPYRF Positions of domains in INVADER1-I_AGp: gag: 1-350; protease: 360-540; reverse transcriptase: 550-1050; integrase: 1085-1363. INVADER1-I_AG is flanked by long terminal repeats, INVADER1-LTR_AG. Solo LTRs or proviral copies are flanked by 4-bp target site duplications. INVADER1_AG has been integrated into the mosquito genome during the last one million years. There is 99% identity of INVADER1-I_AG copies with the consensus sequence.
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute