Repbase Reports

2002, Volume 2, Issue 11
November 30, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 9

GYPSY12_I

GYPSY12_I is an internal portion of the GYPSY12 endogenous retrovirus.

Submitted:
00- - 0
Accepted:
30-Nov-2002
Key Words:
endogenous retrovirus; LTR retrotransposon; gag; pol; GYPSY superfamily; GYPSY12_LTR; GYPSY12_I
Source:
Drosophila melanogaster
Organism:
Drosophila melanogaster
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
GYPSY12, a family of Gypsy-like endogenous retroviruses in drosophila.
Journal:
Repbase Reports 2:(11) p.9 (2002)
Abstract:
GYPSY12_I is an internal portion of the GYPSY12 endogenous retrovirus. Its long terminal repeat is listed in Repbase as GYPSY12_LTR. GYPSY12_I is flanked by 1% divergent LTRs. Therefore, the age of GYPSY12 can be estimated as ~0.3 Myr. tRNA-derived PBS starts at position 35 (there are several GYPSY12-like subfamilies that have the same feature). GYPSY12, OSVALDO and ULYSSES retroviruses from D. buzzatii and D. virilis, respectively, form a distinctive group of GYPSY-like retroviruses. GAG and POL encoded by GYPSY12_I are slightly damaged by several mutations. We recovered both proteins conceptually, based on alignment with known proteins. GYPSY12-GAGp shares common structural motifs with GAGs encoded by HIVs. GYPSY12-POLp is composed of protease, reverse transcriptase and endonuclease. GYPSY12-GAGp (positions 805-2217): MGLDRSPTRKSPSVSNPVCKLCAAEISTQDLYVTTCHHEFYRECIGNHFKKSEICSRCKLTCRPPAEATE RVGRETRSKTKNRRNSRRGSFDISQRCGEKLAVKLKIAATVDGGPSTSASGANANEASSSAVSANAALLA MERRLLATLSEKMADLVQNAITSSMQRIMPTPSPAVVVTASEMSADHPNAYERQYLASPNPVPSPRSASS DLFDRPDKVVHILNGWKIKYSGVGVSVDNFIYRVEAVTRQTLNGNFNLLCRNISVLFEGKANDFFWRYHK FDRVATMGTERFCTALRLQFRQSRDDGDIEELIRNTKQKPNETFDSFYDTVSELVDQLEQPWTANKLVRV LRNNLRPEIRHEILNLDVRTVSELREICKRREAFLADVRRCSSYAKDTPFKREISEVCHESEDEVRSTYE AENDIESFSLVCWNCRIEGHRYQECIAERRVFCYGCGAANTYKPSCRKCSKNFKVGMSKLPVKPKTSNAA RNQSTMTDQ GYPSY12-POLp (positions 2404-5374): KKCKASLDYISSIPTGPRDPRPFLPMRLLNCLVYGLLDSGASISCIGGGVVQAAMENEKFKSLIGEAATA DGNSQRIVGLLKIEVEYGDIKKLLKLYVVPSLKQDLYLGIDFWKLYDLLPANLKIAEILSPEPNQQTVVD QHELCEGDKAKLANVINCFPSFSQEGLGKTNLVSHSIDVGTARPVKQRHFPVSPAVEKAMYAEIDRMLRL GVIGESESAWSSPIVMVTKPGKVRICLECRKVNSFTEMDAYPLPQINGILSRLPRAEYISSLDLKDAYWQ VPLDPKSRDKTAFTVPGRPLYQFKVMPFGLCNATSTMSRLMDKVVPAHLRNEVFIYLDDLLIVSSCFESH LNVLRELALQIKRAGLTLNVAKSHFCMRRVRYLGHIIGDGGIRTDPEKVSAITDFPLPKSLKSLRSFMGL CGWYRKFVANFATLSAPLTDLMTTKRKFLLTKEAIEAFSKLKECLSKAPVLCSPDFAKPFAIHCDASKSG VGAVLVQVSEEGDERPIAFVSKKLNKAQRNYTVTEQECLAAIVALKNFRAYVEGLPFKIITDHASLKWLM SNHDLNSRLARWALALQRFKFEIEHRKGSLNVVPDTLSRVNEEIVAAMDLQEDLIVDFDSEFFQSGDYVK LVETVKENTSNFSDLKVESGFLYRKAEHLTGERMHDEYAWKLWVPKELVSKILARAHDSPLAAHGGIHKT LERIRRYYFWPGLVSDVRAYISACEVCKSTKSQNFTLRPPLGKAPESQRFFQRLFIDFLGPYPRSRSGNI GIFIVLDHFSKYVFLKPVKKIDSSVVIKYLEDELFMTFGVPEVILSDNGSQFRARTFQRLIRYGVKHTLT AVHSPQANASERVNRSVIAAIRAYLRLDQKDWDEFLSRICCALRSAVHSSIGTSPYYMVFGQHMITSGST YSLIRRLNLLDDRSLKFDRHESFEIMRKQAVDQMRNKHNENEKRCNIRSRVVSFVEGQEVYREISSQAVS KPVTTPSLDRRS.
Derived:
Positions 46854 41309 Accession No AE003789 GenBank
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2020 - Genetic Information Research Institute