Repbase Reports

2002, Volume 2, Issue 10
October 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 30

TC1-2_DM

TC1-2_DM is a DNA transposon, a consensus sequence.

Submitted:
31-Oct-2002
Accepted:
31-Oct-2002
Key Words:
DNA transposon; Mariner/Tc1-superfamily; transposase; TC1-2_DM
Source:
consensus
Organism:
Drosophila melanogaster
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
TC1-2_DM, a family of Mariner/Tc1 DNA transposons from D. melanogaster.
Journal:
Repbase Reports 2:(10) p. 30 (2002)
Abstract:
TC1-2_DM belongs to the Mariner/Tc1 superfamily of DNA transposons. It has generated duplications of TA target sites upon its integration into the genome. TC1-2_DM has 26-bp imperfect terminal inverted repeats and it encodes a 340-aa transposase (TC1-2_DMp, positions 356-1375). The sequenced portion of the drosophila genome contains 15 copies of TC1-2_DM. they are ~95% identical to the consensus sequence. Presumably, TC1-2_DM lost its activity just a few million years ago. TC1-2_DMp: MGKTKELSEFIKNEIIIKYNSGISVQNIIDLYKIPRATVYYQINKYKKTHTTKNVARSGRPRKTTQKDDG YILRKFKQNVLQTPRSVAKELKEGAEIDISERTVRRRLKEADFGTYVSRVIPLITPRNKLKRLDFAKKYV GQPASFWNNVLWSDESSFEFHCSKKIFFVRLPKQYRKKVAPVCQRINHSGGSVMFWGCVAFTGLGDLVPV DGTMNQRKYLDVLNNHAFPSGDKLIGESFILQQDNAPCHKAKLITQFLKDVCVNTLDWPPQSPDLNIIEN LWSYLKRKRSANLSRSREETILEIQTLWKDISIDYIHSLVQSVPKRLQKVIDAKGGYIFY
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute