Repbase Reports

2002, Volume 2, Issue 10
October 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 27

R1-2_DM

R1-2_DM is a non-LTR retrotransposon - a partial consensus.

Submitted:
31-Oct-2002
Accepted:
31-Oct-2002
Key Words:
Non-LTR retrotransposon; ORF1; ORF2; R1 clade; endonuclease; reverse transcriptase; R1-2_DM
Source:
consensus
Organism:
Drosophila melanogaster
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
R1-2_DM, a family of R1-like non-LTR retrotransposons from D. melanogaster.
Journal:
Repbase Reports 2:(10) p. 27 (2002)
Abstract:
R1-2_DM belongs to the R1 clade of non-LTR retrotransposons. R1-2_DM is a separate family. Members of this family are ~92% identical to the R1-2_DM consensus sequence. Therefore, this family was active a few million years ago. R1-2_DM is only 70% identical to R1_DM. The sequence is incomplete, its several hundred bp long termini are not reconstructed yet. There are ~15 copies of R1-2_DM present in the sequenced portion of the D. melanogaster genome. The R1-2_DM consensus sequence includes two open reading frames that encode a C-terminal portion of R1-2_DM-ORF1p (positions 1-716) and N-terminal portion of R1-2_DM-ORF2p (positions 719-3216) FW_DM-ORF2p (positions 1256-3832). These proteins are most close to the R1-like DNA/RNA-binding and endonuclease/reverse transcriptase proteins, respectively. R1-2_DM-ORF1p: XXCSAVVMCDDPSIPGKQSAERVRKEVAPALGVRVHEVRELKCGGAVIRTPSVSEMKKVVANKKLAEVGL KVQPKKSQRPKVQVFDVDSGIQPDGGIVRQQFKEEFSPAAFMKEMHLNTKPWSVTDGERANLTLEVDEKA LNVLEQTGRVYIKWFSYRCRSLVHTYACHRCLGFDHKVSQCRVKETICPQCGQAGHTAPRCTNPVDCRNC RFKGHPSRHSMLSFTCPIYGAVLARVNARH R1-2_DM-ORF2p: MFSFLQANCGRGRAPTIELxVRLRDSGHLFALVQEPYVDL AGRITGVPSGMRVFSDRRGKAAVYVDSTDSICMPIEPLVTEFGVCVSVTGSFGSIFLCSVYCQFNTGLEQ YLGYLDAVLLLASRTPVILGLDANAVSPMWFSKLPERAQGSANYLRGELLSDWIQGCRAGVLNMPCDAFT FETPYARSDIDVTLTNDAASTCATYDWRVDEWDLSDHNIINVVVTRDPPNTVESFAPVPSWNFSAARWRP FEDEVTRLASELPDEFADTPLDDQVSAVRSLVHSVCDQVLGRRRPKTARKIVWWTAELSSKRQEVRRLRR RLQTARARASHDAEQLVSQLREISDQYKELILKYKEDNWRRLVGENKDDPWGQVFRICRGRKRTTELGCL RxGGRQYVTWHDCAGVLLRTFFPFSSFRHPLSFLKRFHHRLSSEVDACVARLKSRRSPGMDGITAVIFKA VWRAIPEHITAFYSRCIRSGYLPSKWKRTIAVALLKGSDKDRSDPASYRGICPLLFVFGKVLEGIMVNRL KDVLPDGSRWQFGFREGRCVEDAWRHVVSTVAANQAQYMLGIFVDFKGAFDHVEWDVVMRRLIDSGCREA SLWRSFFSGRSASLVSRYGEVTVPVTRGCPQGSISGPFIWNLMMDSLLQRLEPLRGFSALADDLLLFVEG TRIVLESKGEQLMSVVGAWEVGVAVLTSKTALLLGHFAQSRHTTVRFAGASLPYVDKYRYLGVTVVERLN VLPHIKSLRDRLTGVVQALARVLCVDWGLSPRARRTIYAGLMVPCALFGASVWYDGPSSAMRHLVSCQRR ILLGCLPVCRTVSTVAMQVLxG
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute