Repbase Reports

2002, Volume 2, Issue 10
October 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 8

HELITRON1_AG

HELITRON1_AG, a rolling-circle DNA transposon - a consensus sequence.

Submitted:
31-Oct-2002
Accepted:
31-Oct-2002
Key Words:
DNA transposon; HELITRON class; Rep/helicase; HELITRON1_AG
Source:
consensus
Organism:
Anopheles gambiae str. PEST
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Nematocera; Culicoidea; Anopheles
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
HELITRON1_AG, a rolling-circle DNA transposon from African malaria mosquito.
Journal:
Repbase Reports 2:(10) p. 8 (2002)
Abstract:
HELITRON1_AG is a first example of HELITRONs (a rolling-circle DNA transposons) present in insects. The A. gambiae genome contains many families of HELITRONs. HELITRON1_AF is one of them. A defective copy of a HELITRON-like element is also present in the D. melanogaster genome (AE002840, positions 9827-9264). HELITRON1_AG has all basic hallmarks of HELITRONs: it is flanked by 5'-TC and CTAG-3', is inserted into the AT target site and encodes a 1792-aa HELITRON-like Rep/Helicase protein, called AGHEL1p. AGHEL1p (positions 820-6195): MQPSVSDIVSQNLTPPEETPNEKKARLQRKRQALYRAKKRLPGAAPTLAAVQDDQQAVPSTLAGSSLSAA SAILQQQQRRNTDDELLNEIAGRYSTPPDETPPEKKARLARKRQALYRAKKRLAGAAPTVAAVQDDQQAV PSTSAGTSLSGAPAILQQQQLRRNIDDDLLNEIAGRYSTPPDETPPEKKARLARKRQALYNARKRMVQTP NVATVVNRAPAPASAPVPAPAPAPTPALVDPTAAVAIRVPIHQQLQTYVRHLRDHEADQQRQFIARRRMT GHLRVAHGNHESYSCPSLHTLAPRVPCNFCSALKWPGEPPSVCCNSGQVVLPPFPEPPAELRQLFDVPQF LLNIRRYNNAFAFTSIGASIRGNDPVRQDLRVGHGGIYNYRIQGALCHRIGSLAVLPGRPPCYAQLYFYD SSSEGQYDEMLNARAKAYGSELNREILAILQRVFSTHNPIAEMFKHAYERMSVRDDLRLCIHSRIPGIDQ RRYNAPTADEVGGVFVCDDTTGATEHTRDIVLQHRATGYLQPVFDTNQLADALQYPILFPRGETGWTYGM PKVQRRTRQQQQPSRPTSSSNGAAHIDENDDAAEDPNPELDGAERSANQITPREYAAYRIAWRENAQTLM HRAGRLFQQYCVDQYCKIEMQRLKYLREHQAQLRTEAYTGFMDLAGAEGTIADLHPDNLPNVAVEIPVVQ EPPVAPRRSIIDPPSNLSRTGTRVILGPSFVGSNRYMRAQYQDAMAIVRALGKPDLFITVTCNPKWPEIT QCLLPRQQAPDRPDVIVRVFRLKLKAILNDLTMGALGIEVARIHVIEFQKRGLPHAHILVILAEEDKPQT PADYDKIVSAELPNPATSSQLFETVQSCMMHGPCGAANPAAPCMKDGTCEKGFPKSFCEQTRSMDNGYPQ YRRRNNGRSVTVKGIELDNRYVVPYNPWFTHKYNCHINVEVCTSISSVKYLYKYVYKGHDRLSVTLAVGN DEIQQHIDARYLSPTDSCWRIMRFELQAKTHTVVTLPIHLENQQNVFFRANETVSCVLNRGNHTMLTRFF QLAAHDNFARALLYHDVPTYYRYAKPTANQRLPWQEPGTKHWIRRIRTGHKTVIGRMVSCSMQLMERYCL RLLLCYRKGPTSYEDLRTVNGSVCETFQQAAINEGLLEDDSEWDRALEEAATYRMPAQLRHFFALILSSG MPQNPRTLWESYASEMSEDFHHRNRDRYTTEESDLNKLLRDVEHFRALSDIDRYLRGTTPSKVLTSSPGM PQLSEYEHVQAHIMDDDDVNEFIIAERSYLITDLDATLATVHQLNDEQRMVYETVTAAIDRQLATAASQA NAGDQRLFFLDGPGGTGKSFLVEKILAHVRRCGEIALATAASGIAALLLTGGKTVHSTFKLPLDLNNHST CSITVQSKRAEMLRQTALIVWDEASMSSRFALEAVDRTLQDITGVQLPFGGKVVLLSGDFRQILPIVPKG TDAQIINECIKKSTLWPLFRSLQLRDNMRVRTAPNANQASELRDFANLLLRIGEGRHDTFAGLDPSLAKI PHDMIVPHTANPTNDLNTLIDKIYPDMQRHFQHPSFFSDRAILSPLNVDVASVNNLVLDRIPGPEQEYRS VDTLVNPEEHEHLQLPSEYLNTLNVSGIPVHRLRLKRFAPVLLLRNLNSDMGLCNGTRLQIVGLKRNCLH AKILTGTRRGEDVLLPRIFCDSNDKGHPFQIRRKQFPVQVCFAMTINKSQGQSLHHLGLYLPQDVFAHGQ LYVALSRVTSRANIAVLIPNPKRADEEGVSTSNIVYREVVDR
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute