Repbase Reports

2002, Volume 2, Issue 10
October 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 7

G5A_DM

G5A_DM is a non-LTR retrotransposon - a partial consensus sequence.

Submitted:
31-Oct-2002
Accepted:
31-Oct-2002
Key Words:
Non-LTR retrotransposon; ORF2; DNA binding protein; AP endonuclease; reverse transcriptase; JOCKEY clade; G5A_DM
Source:
consensus
Organism:
Drosophila melanogaster
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
G5A_DM, a subfamily of non-LTR retrotransposons from the Jockey clade.
Journal:
Repbase Reports 2:(10) p. 7 (2002)
Abstract:
G5A_DM belongs to the JOCKEY clad of non-LTR retrotransposons. G5A_DM forms a separate subfamily of retrotransposons that were recently (several million years ago) active in the Drosophila melanogaster genome. There are about 50 copies of G5A_DM in the genome, they are ~7% divergent from the consensus sequence. The G5A_DM and G5_DM consensus sequences are 80% identical with each other. The G5A_DM consensus is not complete, approximately a 2000-bp 3' portion of the element is not present here. The ORF2 is reconstructed completely. It encodes the 904-aa G5A_DM-orf2p endonuclease and reverse transcriptase (positions 16-2727). G5A_DM-orf2p: MGPLRIPTWNSIGASLKTNEFLALIELHDIDILLLSEVHFSSRSNFRVNGFTLHTANHPDDSQHGGAAIL VGSNISHQPFATLSQNHIQAVVIQLTASRGNFNVASVYCPPTLRWTDAIVGQFITQFGTKFLAAGDWNAK HRWWGNYRMRTRGRVLYSALAEEGIDIVATGEATCYPYRATASPSAIDFGISKGFRQQQIKVQLLSSDHL PLLFELDEDAQSFRSVTKMLSPQANIRIFKEHIEATVELNIPIDTCSRLEAYVDYFTPAIIEAARQATPT PHQARLTAIRRPPILSIEARDLLSHKRRLRRRYIATGDPSIYQQYSSTTNRLRRLLANNRKANLDTLLEG AGPDSNSGFSIWKLTRGIKRQPLFQSPIQDRGGLWLKTDDEKASAFASHLSSTFMPFNLTDDTNREAIAN FLDTPTAPTRPIRHTSPQEVMMQLKALQPKKNPGYDGIDNRTAKFLPRKGVLALVKIFNVMLRLGHFPRQ WKRARIVMIPKPGKSPTQIDSYRPISLLPTFSKVFERILLTRLMELPQVTEHIPQHQFGFRKSHGCPEQI HRLVKHITHGFEHKLYTVGVFLDVKQAFDKVWHEGLLYKMKDLLPAAHYAILSSFIADRTFDVAVRDSRS SMEHIHAGVPQGSVLGPFLYTLYTADMPTPVNNTDEASPAQLILATYADDTAMLASHSSLQFASNAVQEW LHAIERWTAKWNIAINCTKSACVTFTLRPQTCLGLLFDGNTIDYVSSHCYLGVHLDRTLSWKAHITAVRA KSSWKLKKLDWLFHSSKLHMATKALLIKAILGPTLTYAIQVWGTASKTQLNRLRVIQSRAARHASGLPWY VSNRVIERDLKVVPLGDQINFHSSRYADRLSAHPNTLANDLVDPISLRRLKRIHPHELLTRKIV
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute