Repbase Reports

2002, Volume 2, Issue 10
October 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 5

FW2_DM

FW2_DM is a non-LTR retrotransposon - a partial consensus.

Submitted:
31-Oct-2002
Accepted:
31-Oct-2002
Key Words:
Non-LTR retrotransposon; ORF1; ORF2; JOCKEY clade; endonuclease; reverse transcriptase; FW2_DM
Source:
consensus
Organism:
Drosophila melanogaster
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
FW2_DM, a family of Jockey-like non-LTR retrotransposons from D. melanogaster.
Journal:
Repbase Reports 2:(10) p. 5 (2002)
Abstract:
FW2_DM belongs to the JOCKEY clade of non-LTR retrotransposons. FW2_DM is a separate family. Members of this family are ~95% identical to the FW2_DM consensus sequence. Therefore, this family was active a few million years ago. FW2_DM is 68% identical to FW. The sequence is incomplete, a ~500-bp 5' terminal portion of FW2_DM is not reconstructed yet. There are 10 copies of FW2_DM present in the sequenced portion of the D. melanogaster genome. The FW2_DM consensus sequence includes two open reading frames that encode the 417-aa FW2_DM-ORF1p (positions 2-1249) and 859-aa FW_DM-ORF2p (positions 1256-3832). These proteins are similar to the Jockey-like DNA/RNA-binding and endonuclease/reverse transcriptase proteins, respectively. FW2_DM-ORF1p (positions 2-1249): XSTTQTAIDRYIQIKRKLSPQNYSMGNKSKINCDITRQKTNMPNNDNRFAILADLDDLPNSDKDIKKTPK PPPIYIREKSSSALVNKKMDLIEKDSFHIIPLTKGNIHETKVQVKTEVNFRALTKYLNDAKKNFYTYQPK SSKGLQSSIKGLRPEITPEEISGAQIEQGFKPKSVINIFNKDKKPQPLFKVELEPDSWALKKNESHPIYK LQYLLHRRISVEEPHKRKGPVQCANCQEYGHTKTYCTLRTVCVACGELHSSVNCPSNKADPGMKKCSNCG GNHTANYRGCPVYKDLKNRLHQKVTMMRGQSTPSTIIPSKHTPDVHLNSLTNRNVTFASALKSGLASTNP TTPFPLAEQNKVNADQPTGQPQGNIETMIFNLQQSMTEFMTFMRTTMENLMRNQDLLIQMLVSQQSK FW2_DM-ORF2p (positions 1256-3832): MAPLRITLWNANGVSRHKLEMAQFLQDKHIDVMLLSETHLTNKYKFQINGYIFYGTNHPDGKAHGGTGVL IRNRIKHTFRNDFGTNYLQATSLNIQLGNGQITLAAVYWPPRFTISENQFLDFFNTLGDRFIAAGDYNAK HTHWGSRLVTAKGKLLYKTIIKVSNKLSCASPGTPTYWPTDPRKIPDLIDFAVTRNISHNHINAESLPDL SSLAGLINYLQYADLKNSPCRVTSNRTNWLKYKKFVSSHIQCLNPRKKQTVQYMQRKPNVQIEQLVLKKR RLRREWQSYRSPFAKQGLNNATHTIRKEVINEQECAQRPYIAQLSPFSTKYPLWGLHPSVSPPVESVVPI RNSAGEWVRSDKHRASTFAEHLQNVFQPKPATNNFVLQEQTVVSQTTQNTIEFRPTEIAKIIKELKPNKS PGSDLINPKMIIELPFCAVQTICQLFNAINRIGHFPSLWKKSIIIMIPKPGKDHTVPSSYRPVSLLPCMS KLFEKCLLTFIIPYLRTFNKIPEHQFGFQEKHGTIExVNRITTEIRTAFEKREYCTAIFLDVAQAFDRVW LDGLMHKIMSTLPECTHKLLKSYLHNRVFSVRCGTVTSEDHIIEAGVPQGSVLGPTLYLLYTADIPTSRQ LTISTFADDTAILSRSKCPRQATAQLALYLAHIEKWLSDWRIKVNEQKCKHVTFTLNRQDCPSLILNNTV IPKSNEVTYLGIHLDRRLTWRRHIEAKRTHLKLKANSLHWLLSIRSPLRLEYKVLLYNSVLKPTWTYGSQ LWGNASNSSVEIIQRAQSKILRTITGAPWYVRSDNLHRDLFILPVRDEIAKQMEKYRNKLRAHPNRLARD LTRLSSRTRLRRNDMPTQR
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute