Repbase Reports

2002, Volume 2, Issue 10
October 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 3

DOC4_DM

DOC4_DM is a non-LTR retrotransposon - a partial consensus.

Submitted:
31-Oct-2002
Accepted:
31-Oct-2002
Key Words:
Non-LTR retrotransposon; ORF1; ORF2; JOCKEY clade; reverse transcriptase; DOC4_DM
Source:
consensus
Organism:
Drosophila melanogaster
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
DOC4_DM, a family of Jockey-like non-LTR retrotransposons from D. melanogaster.
Journal:
Repbase Reports 2:(10) p. 3 (2002)
Abstract:
DOC4_DM belongs to the JOCKEY clade of non-LTR retrotransposons. DOC4_DM is a separate family. Members of this family are ~94% identical to the DOC4_DM consensus sequence. Therefore, this family was active a few million years ago. DOC4_DM is <70% identical to reported retrotransposons. The sequence is incomplete. There are ~20 copies of DOC4_DM present in the sequenced portion the D. melanogaster genome. The amount of sequence data is not sufficient for a complete reconstruction of the ORF2 protein encoded by DOC4_DM. The ~400-aa internal portion of ORF2p is not reconstructed. ORF1p (positions 1-1743): QNEIREQRQREQDERRLSSIKNNAYFSFVSTETLKPSQDQRAHSCSPSLPSTVPKSWSEECASPMPQPTT NYTQTPLTIVAKPPLLSLAAVTTSTVASLTTAIASTTTLTATVSSTQTIQSTTSRAFALQAKQLTATITD LRESKSNPSGRPNSVMQTGMDRYVFVKRKRSPQRTTGNRAKINCGSETKTTTTNNKNMFALLAENASEEA NKTTDSVSQKPKPPPIYIQEITTNALANKIVQLIANNNFHVIPLRRGKIQETKLQVKTEDQFHAVSKFLN ENGKKYYTYQLKSSKGLQVVLKGIEPDVTPNEVANALHEKGFNVKSVINILNKDKKPQPLFKVELDPTSQ TLKRNEVHPIYNLQFLLHRKITVEEPHKRNGPVQCSNCQEYGHTKTYCTLPSVCVACGDLHESGTCPANK LDPNSKKCGNCGENHTANYRGCPVYKDLKSRMNKRIASARSTNNTQKIWYPKNVWYPPNRFLTFSSPTPN CHPLPPVSTIPGVSFASALKSGTEGPASTTEFSKAPQPRAVPDDLQQPTSAIEKIMLSFQATMTEFMSFM RTTMQDLTCALVQVLASQHSK
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute