Repbase Reports

2002, Volume 2, Issue 10
October 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 2

BS4_DM

BS4_DM is a non-LTR retrotransposon - a partial consensus sequence.

Submitted:
31-Oct-2002
Accepted:
31-Oct-2002
Key Words:
Non-LTR retrotransposon; ORF2; reverse transcriptase; JOCKEY clade; BS; BS4_DM
Source:
consensus
Organism:
Drosophila melanogaster
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
BS4_DM, a family of non-LTR retrotransposons from the Jockey clade.
Journal:
Repbase Reports 2:(10) p. 2 (2002)
Abstract:
BS4_DM belongs to the JOCKEY clade of non-LTR retrotransposons. BS4_DM is a family of retrotransposons that were active in the D. melanogaster genome a few million years ago. Two copies of BS4_DM are present in the sequenced genome, they are 7% divergent from each other. There is a 68% nucleotide identity between BS4_DM and BS. Protein sequences encoded by these elements are also 68% identical to each other. Therefore, a strong stabilizing selection was channeling evolution of these non-LTR retrotransposons. BS4_DM encodes BS4_DMp, a portion of the reverse transcriptase. BS4_DMp: SYLDGRKLMVRYTDTYSAPCQMLAGVPQGSVLGPLLYSLYTADLPRPTYENAQYPSKAIIATYADDIAVL YRSKCRIEAANGLQGYLQTLSAWSRRWNMKVNPLKTFNPCFTLKRLATPAIQFEGVTLEQPSQAKYLGIT LDKRLTFGPHIKTITKRCGQRMQHLRWLINKRSTMSLRAKRAVYVDCIAPTD Approximately, a 4-kb 5' portion is missing in the current version of the BS4_DM consensus sequence.
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute