Repbase Reports

2002, Volume 2, Issue 10
October 31, 2002
Copyright © 2001-2016 - Genetic Information Research Institute
ISSN# 1534-830X
Page 1

BS3_DM

BS3_DM is a non-LTR retrotransposon - a partial consensus.

Submitted:
31-Oct-2002
Accepted:
31-Oct-2002
Key Words:
Non-LTR retrotransposon; ORF2; JOCKEY clade; reverse transcriptase; BS3_DM
Source:
consensus
Organism:
Drosophila melanogaster
Taxonomy:
Eukaryota; Metazoa; Arthropoda; Tracheata; Hexapoda; Insecta; Pterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila
[1] Authors:
Kapitonov,V.V. and Jurka,J.
Title:
BS3_DM, a family of Jockey-like non-LTR retrotransposons from D. melanogaster.
Journal:
Repbase Reports 2:(10) p. 1 (2002)
Abstract:
BS3_DM belongs to the JOCKEY clade of non-LTR retrotransposons. BS3_DM is a separate family. Members of this family are ~93% identical to the BS3_DM consensus sequence. Therefore, this family was active a few million years ago. BS3_DM is 75% identical to BS2. The sequence is incomplete, a ~2500-bp 5' terminal portion of BS3_DM is not reconstructed yet. There are ~30 copies of BS3_DM present in the sequenced portion of the D. melanogaster genome. The 539-aa C-terminal portion of reverse transcriptase, BS3_DM-orf2p, is encoded by the BS3_DM consensus sequence (positions 2-1618). BS3_DM-orf2p: IKRRCARKAPLADNSGAWCRTFIEQAEVFAVHLAERFQPLNLASPQDVDATHDQLSQALQMDLPMQPITP SEIADVIAKQNPKKAPGHDTTCNSTLRTLPRCAILYITLLFNAMVRLQYFPPQWKLGIISMIHKPGKPEK NPGSYRPISLLPSISKVFERLIAARMVRIMEAKGILPEHQFGFRAGHCTVEQLHRVVEQILSAFENKEYC NALFLDVREAFDRVWHSGILLKIKNTLPAPYFGLLRSYLEKRRFAVRFHSALSNEHNVAAGVPQGSVLGP LLYCLYSYDMPRPDVSLPGTSMLATFADDVCVTYRSCCEHDAADDIQDFASTFAEWAKRWNIGINGDKSA NVCYTLKRKTPPAVLIDGTPVPQSNSAKYLGVILDRRLNFSKQVSAMRVRIRAAASKHFWLINSRSKLSL SNKVTIYKQIIAPIWRYGCQIWGLACDSQIRRIQAAQNKIARMITGCEWYVRNTTLHKDLKLATVFEAIN MHSSRYHDRLERHRNRLAKALSRARPPRRLHRRQPKDLIIRSPLTRARR
Derived:
[1] (Consensus)
Download Sequence - Format:
IG, EMBL, FASTA
References:

© 2001-2019 - Genetic Information Research Institute